DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6472 and CG4582

DIOPT Version :9

Sequence 1:NP_611166.2 Gene:CG6472 / 36895 FlyBaseID:FBgn0034166 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster


Alignment Length:293 Identity:106/293 - (36%)
Similarity:148/293 - (50%) Gaps:42/293 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 SAQLLHLSDDARLAQSNFN-FNYPLAIYLHGF--SESATGERQSSQELKDAF--LRRGNYNVILI 115
            :::.::|.|.|.|.:|.|: || |..|.:||:  :|:|    ....||..|:  ||.||||:..:
  Fly   142 TSEPVNLYDAASLRRSRFSPFN-PTRILIHGWLGNENA----NMYNELLPAYFDLRNGNYNIFTV 201

  Fly   116 DWSAMTAVPWYSNAVENLPVSGRYLARFLRFL-VDKGYPAKYIHLIGFSLGAEVAGFAGKQLQEW 179
            || ...|:..|..|...:...|:.||:|:.|| .:.|...:.:.|:|||:||.|||.|||.||..
  Fly   202 DW-GRGAIADYITASYRVKPVGQVLAKFVDFLHQEAGMRFEDLQLVGFSMGAHVAGLAGKHLQTG 265

  Fly   180 GIKLPRITALDPALPLFEGNSSNRRLSPSDARFVDVIHTDGGLLGNPAPMGHADFYPNGGRPLQP 244
            .:::  |.|||||||.|.......||:..||.:|:|:||..|..|...|:||.|||.|.|.. ||
  Fly   266 RLRM--IRALDPALPFFRYAKPKERLTAEDADYVEVLHTSVGSYGFDRPVGHVDFYANWGSQ-QP 327

  Fly   245 GCAKQNIANNWLGIIVGCSHQRAWEYFVESIA--QPRGFPAQRCE-------------PSDMFGI 294
            ||....           |||.||:..|.||:|  |..||.:|.|.             |.|. |:
  Fly   328 GCFWHE-----------CSHWRAFMLFAESLARDQATGFLSQGCPAAEWQQLTRFHRCPKDT-GV 380

  Fly   295 CREPGGGPAFMGMGADPRIRGKFYLDTNDAKPF 327
            .:..||..|.:......:.:|.:|..|||..|:
  Fly   381 MQTMGGDLANVSAEFLAQRQGVYYFQTNDQPPY 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6472NP_611166.2 Pancreat_lipase_like 43..323 CDD:238363 103/287 (36%)
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 103/287 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446057
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.