DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6472 and CG10116

DIOPT Version :9

Sequence 1:NP_611166.2 Gene:CG6472 / 36895 FlyBaseID:FBgn0034166 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster


Alignment Length:294 Identity:87/294 - (29%)
Similarity:136/294 - (46%) Gaps:42/294 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 FMLYTSRNRNSAQLLHLSDDARLAQSNFNFNYPLAIYLHGFSESATGERQSSQELK---DAFLRR 107
            |.|.|.|.:.:||.:....:| |.:|:|....|..:.:..:..:.     ||.|:.   .|.|::
  Fly    24 FFLNTRRVQENAQPIEAEVEA-LVRSSFYAADPTVVTIPRWLGNI-----SSPEIPAVVSARLQQ 82

  Fly   108 GNYNVILIDWSAMTAVPWYSNAVENLPVSGRYLARFLRFLVDKGYPAKYIHLIGFSLGAEVA-GF 171
            .:.|:|.:|.|.........::|.:|.:       .|....|  .|...|.::||:.||.:| |.
  Fly    83 QDSNIISVDLSEANDETEIIDSVASLVI-------VLHNQFD--MPLDRILVVGFAEGAHLAGGV 138

  Fly   172 AGKQLQEWGIKLPRITALDPALPLFEGNSSNRRLSPSDARFVDVIHTDGGLLGNPAPMGHADFYP 236
            |.|..|:.|.:|.:||||||:    .|...:.:||.:||.||:|:||:.|..|....:||.|:||
  Fly   139 AAKVQQDLGRQLSQITALDPS----SGAELDHKLSQADAEFVEVVHTNAGGEGTWERLGHVDYYP 199

  Fly   237 NGGRPLQPGCAKQNIANNWLGIIVGCSHQRAWEYFVESIAQPRGFPAQRCEPSDMFGI--CREPG 299
            |||: .||||...:           |||:||:|...|..:....|.:.||...:....  ||   
  Fly   200 NGGQ-TQPGCTTDS-----------CSHERAFELLAEMWSPENDFVSARCGSVETLSASSCR--- 249

  Fly   300 GGPAFMGMGADPR--IRGKFYLDTNDAKPFGRNS 331
            .....||...:..  ..|.::|:|..:.||.|.:
  Fly   250 WSTHKMGQKQEEEQPASGIYFLETRQSSPFSRGA 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6472NP_611166.2 Pancreat_lipase_like 43..323 CDD:238363 84/284 (30%)
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 83/283 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446004
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.