DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6472 and lipca

DIOPT Version :9

Sequence 1:NP_611166.2 Gene:CG6472 / 36895 FlyBaseID:FBgn0034166 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_957316.1 Gene:lipca / 393997 ZFINID:ZDB-GENE-040426-1361 Length:514 Species:Danio rerio


Alignment Length:279 Identity:108/279 - (38%)
Similarity:144/279 - (51%) Gaps:23/279 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 IKEREDIK--FMLYT-SRNRNSAQLLHLSDDARLAQSNFNFNYPLAIYLHGFSESATGERQSSQE 99
            :|.|.:.|  |.:|| .........|.|.....|....||.:.||||.:||:|.....|:..|:.
Zfish    36 MKMRYEPKSVFRVYTDGEYTEDTCALELFQPHTLDACGFNSSLPLAIIIHGWSVDGMMEKWISRL 100

  Fly   100 LKDAFLRRGNYNVILIDWSAMTAVPWYSNAVENLPVSGRYLARFLRFLVD-KGYPAKYIHLIGFS 163
            ........||.||::.||..: |...|..|.:|..:.|:.:|..|.:|.| |.:|...:||||:|
Zfish   101 ASALKSSEGNINVLIADWLTL-AHQHYPIAAQNTRIVGQDIAHLLSWLEDFKQFPLGKVHLIGYS 164

  Fly   164 LGAEVAGFAGKQLQEWGIKLPRITALDPALPLFEGNSSNRRLSPSDARFVDVIHT-----DGGLL 223
            |||.::||||..|...|..|.|||.||||.|:|||.|...||||.||:|||.|||     .|..:
Zfish   165 LGAHISGFAGSNLAMSGRTLGRITGLDPAGPMFEGMSHTDRLSPEDAKFVDAIHTFTLQRMGLSV 229

  Fly   224 GNPAPMGHADFYPNGGRPLQPGCA--KQNIANNWL--GII-----VGCSHQRAWEYFVESIA-QP 278
            |...|:.|.||||||| ..||||.  .|||..:..  ||:     |.|:|:||...|::|:. :.
Zfish   230 GIKQPVAHFDFYPNGG-SFQPGCQLHMQNIYAHLAQHGIMGFEQTVKCAHERAVHLFIDSLLNKD 293

  Fly   279 RGFPAQRCEPSDMF--GIC 295
            :...|.:|..:..|  |.|
Zfish   294 KQIMAYKCSDNTAFDKGNC 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6472NP_611166.2 Pancreat_lipase_like 43..323 CDD:238363 106/274 (39%)
lipcaNP_957316.1 lipo_lipase 44..488 CDD:132274 105/271 (39%)
Pancreat_lipase_like 54..344 CDD:238363 102/261 (39%)
PLAT_LPL 351..485 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578611
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8473
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.