DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6472 and CG13562

DIOPT Version :9

Sequence 1:NP_611166.2 Gene:CG6472 / 36895 FlyBaseID:FBgn0034166 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster


Alignment Length:311 Identity:69/311 - (22%)
Similarity:118/311 - (37%) Gaps:55/311 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 REDIKFMLYTSRNRNSAQLLHLS--DDA-RLAQSNFNFNYPLAIYLHGFSESATGERQSSQELKD 102
            ::.:|.|.|    :|:.:.:..|  ||| .|:.|..:.....||.|||:.:|.:.|...|...:.
  Fly    58 QKTMKVMFY----KNNTKTMETSAYDDAYDLSGSGCSPTDKFAIVLHGWIQSCSDEWALSLIERL 118

  Fly   103 AFLRRGNYNVILIDWSAMTAVPWYSNAVENLPVSGRYLARFLRFLVDKGYPAKYIHLIGFSLGAE 167
            ::.|.|  .||.||:| :.|...|.....|.......::..:..|..:|:..|..::.|||.|.:
  Fly   119 SYYRGG--CVICIDYS-VVASSSYMRLYTNFDTLTGAISSIILTLFRQGFDPKRGYMFGFSFGGQ 180

  Fly   168 VAGFAGKQLQEWGIKLPRITALDPALPLFEGNSSNRRLSPSDARFVDVIHTDGGLLGNPAPMGHA 232
            :|...|:.|:...| :..|...|.|.|.|                 |.|..|....|......|:
  Fly   181 LASAVGRSLRPHHI-IESIDTCDMAGPGF-----------------DPIAVDHSKAGKHVQCFHS 227

  Fly   233 D-----FYPNGGRPL--------QPGCAKQNIANNWLGIIVGCSHQRAWEYFVESIAQPRGFPAQ 284
            .     |..:..|.:        ||..|.|        :.:| ||....:.::.:...|  |.|.
  Fly   228 SRDKGTFVYSCHRNIMLGSCGLKQPSVASQ--------LHLG-SHGLCVDIYINTFDYP--FYAV 281

  Fly   285 RCEPSDMF---GICREPGGGPAFMGMGADPRIRGKFYLDTNDAKPFGRNSR 332
            ...|.:.|   ...:.|.|.........|.::.|:.::.|:...|:..:.:
  Fly   282 NYTPPECFTWQKTAKIPDGYTVGYEENFDSQVTGQIFVPTSLHYPYNLSKK 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6472NP_611166.2 Pancreat_lipase_like 43..323 CDD:238363 68/298 (23%)
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 42/151 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.