DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6472 and CG6431

DIOPT Version :9

Sequence 1:NP_611166.2 Gene:CG6472 / 36895 FlyBaseID:FBgn0034166 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001188790.1 Gene:CG6431 / 34476 FlyBaseID:FBgn0032289 Length:351 Species:Drosophila melanogaster


Alignment Length:312 Identity:93/312 - (29%)
Similarity:137/312 - (43%) Gaps:36/312 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 TCCAIKEREDIKFMLYTSRNRNSAQLLHLSDDARLAQSNFNFNYPLAIYLHGFSESATGERQSSQ 98
            ||    .:..|.:.|:||........|::.:...|.:..|:.:......:|||:.:|....  .|
  Fly    55 TC----PKRFIDYQLFTSNGPRRGTPLNVKNPITLYKGGFSKHRETVFIIHGFNGTAIDIH--LQ 113

  Fly    99 ELKDAFLRRGNYNVILIDWSAMTAVPWYSNAVENLPVSGRYLARFLRFLVDKGYPAKYIHLIGFS 163
            .|:||:|.| ::|||.:||..:|..|.|.:::.|..::.:..|:...||...|...:.|..:|.|
  Fly   114 FLRDAYLSR-DFNVITVDWRPLTRYPCYLHSLINTRLTAQCTAQIYAFLTHYGAVRERITCVGHS 177

  Fly   164 LGAEVAGFAGKQLQEWGIKLPRITALDPALPLFEGNSSNR-RLSPSDARFVDVIHTDGGLLGNPA 227
            |||.:.|.....|..   |..||..||||.||.|...||: |||..||..:.|:||:.|.||...
  Fly   178 LGAHICGMISNHLTR---KQYRIIGLDPARPLIERMKSNKFRLSIDDANVIQVLHTNAGFLGQED 239

  Fly   228 PMGHADFYPNGGRPLQPGCAKQNIANNWLGIIVGCSHQRAWEYFVESIAQPRGFPAQRCEPS--- 289
            ..||.::..|||| :||.|....|..:      .|||..:..|...:..:...|....| |:   
  Fly   240 NSGHLNYCVNGGR-IQPFCKGNPIRKS------RCSHFLSICYLATATFKHNKFMGVPC-PNGCL 296

  Fly   290 DMFGICREPGGGPA------------FMGMGADPRIRGKFYLDTNDAK--PF 327
            ::.|..|.|..|..            .:|..|....||...:|...||  ||
  Fly   297 NLSGSKRLPVSGKVNPFEFASLIREYHIGNDAPDDARGCICIDVPYAKHCPF 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6472NP_611166.2 Pancreat_lipase_like 43..323 CDD:238363 87/295 (29%)
CG6431NP_001188790.1 Abhydrolase 63..293 CDD:304388 76/243 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.