DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6472 and CG14034

DIOPT Version :9

Sequence 1:NP_611166.2 Gene:CG6472 / 36895 FlyBaseID:FBgn0034166 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001036339.1 Gene:CG14034 / 33751 FlyBaseID:FBgn0250847 Length:338 Species:Drosophila melanogaster


Alignment Length:299 Identity:112/299 - (37%)
Similarity:153/299 - (51%) Gaps:23/299 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 DIKFMLYTSRNRNSAQLLHLSDDARLAQSNFNFNYPLAIYLHGFSESATGERQSS--QELKDAFL 105
            :|.|.|||..|:...:|    ....|.:..|..:.||.:.:|||:    |.|..|  .:|:..||
  Fly    37 NISFWLYTKENQEGTKL----SVFELNRFEFYHHKPLKVLIHGFN----GHRDFSPNTQLRPLFL 93

  Fly   106 RRGNYNVILIDWSAMTAVPWYSNAVENLPVSGRYLARFLRFLVDKG-YPAKYIHLIGFSLGAEVA 169
            .: :||:|.:|:..:...|.|:.||.|.....|..|:.||.|::.| ...:.:||||..|||.||
  Fly    94 TQ-DYNLISLDYPKLAYEPCYTEAVHNAKYVARCTAQLLRVLLESGLVKIEDLHLIGLGLGAHVA 157

  Fly   170 GFAGKQLQEWGIKLPRITALDPALPLFEGNSSNRRLSPSDARFVDVIHTDGGLLGNPAPMGHADF 234
            ||.|:.|.|.  ||..|||||||.|.:.......:|.|:||:||||:|||..:||....:||.||
  Fly   158 GFIGQFLPEH--KLEHITALDPAKPFYMVKDPALKLDPTDAKFVDVVHTDVTMLGLLDAVGHVDF 220

  Fly   235 YPNGGRPLQPGCAKQNIANNWLGIIVGCSHQRAWEYFVESIAQPRGFPAQRCEPSDMF--GICRE 297
            |.|.| ..||.|...|......     |.|.||.:|:.|||:.|.||....|.....|  ||| .
  Fly   221 YLNMG-VSQPNCGPINKMETHF-----CYHNRAADYYAESISSPSGFYGFYCPNFKSFAKGIC-I 278

  Fly   298 PGGGPAFMGMGADPRIRGKFYLDTNDAKPFGRNSRARAI 336
            |......||...||:.||:::||||:..|:.:.....:|
  Fly   279 PDKNIELMGFHVDPKARGRYFLDTNNGPPYAKGENFTSI 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6472NP_611166.2 Pancreat_lipase_like 43..323 CDD:238363 109/284 (38%)
CG14034NP_001036339.1 Pancreat_lipase_like 37..303 CDD:238363 108/283 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446000
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.