DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6472 and CG4267

DIOPT Version :9

Sequence 1:NP_611166.2 Gene:CG6472 / 36895 FlyBaseID:FBgn0034166 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001259919.1 Gene:CG4267 / 33405 FlyBaseID:FBgn0264979 Length:374 Species:Drosophila melanogaster


Alignment Length:371 Identity:109/371 - (29%)
Similarity:164/371 - (44%) Gaps:83/371 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LLAGSPIFYSAA-------PRGSCSTCCAIKE----------------------REDIKFMLYTS 51
            |||.:.|.::::       |..:|:.....|:                      |..::|:|:..
  Fly    15 LLAFAAIVFASSSEKTELDPNATCNYTLVKKKTLGVDPSFWKKFFKHLIPFTSSRGKMQFILFKR 79

  Fly    52 RNRNSAQLLHLSDDARLAQSNFNFNYPLAIYLHGFSESATGERQSSQELKDAFLR------RG-- 108
            ...:..:.|.:.|...|..|.|:..:...|.:||:...:.|..  .:::|:|:|.      .|  
  Fly    80 DFADCGRELFVGDVENLRNSGFDARHQTRIVIHGWMSQSKGSH--IRKVKNAYLSLTDPGPNGEP 142

  Fly   109 ----NYNVILIDWS-AMTAVPWY--SNAVENLPVSGRYLARFLRFL---VDKGYPAKYIHLIGFS 163
                ::|||:.||| ..|.|.:|  :..||::   |..||..:|:|   .:..|...|:  ||.|
  Fly   143 APYEDFNVIVCDWSKTSTNVNYYEVAKTVEDM---GALLAELVRYLNQEANMHYDDVYV--IGHS 202

  Fly   164 LGAEVAGFAGKQLQEWGIKLPRITALDPALPLFEGNSSNRRLSPSDARFVDVIHTDGGLLGNPAP 228
            |||::||.||||:..:  :...|.|||||.|.|...|...|:..|||.:|:.|.|... .|...|
  Fly   203 LGAQIAGSAGKQIMPY--RFNTIYALDPAGPQFREKSDEYRIDASDASYVESIQTSVS-FGFEQP 264

  Fly   229 MGHADFYPNGGRPLQPGCAKQNIANNWLGIIVGCSHQRAWEYFVESIAQPRGFPAQRCEPSDMFG 293
            :|||.||||.|:. |..|           .:.||||:|:.:||:||:..|.||...|||..|   
  Fly   265 VGHATFYPNYGKN-QKKC-----------YVYGCSHKRSHDYFIESLTSPAGFWGPRCERHD--- 314

  Fly   294 ICREPGGGPAFMG-----MGADPRI--RGKFYLDTNDAKPFGRNSR 332
                .|.....|.     ||.:|.|  .|.||:.|....|:....|
  Fly   315 ----DGTWLLLMSDGEFRMGGEPSIPKNGTFYVKTYSKPPYAMGHR 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6472NP_611166.2 Pancreat_lipase_like 43..323 CDD:238363 99/304 (33%)
CG4267NP_001259919.1 Lipase 64..351 CDD:278576 100/315 (32%)
Pancreat_lipase_like 71..347 CDD:238363 99/304 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446059
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.