DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6472 and CG5162

DIOPT Version :9

Sequence 1:NP_611166.2 Gene:CG6472 / 36895 FlyBaseID:FBgn0034166 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001285367.1 Gene:CG5162 / 32709 FlyBaseID:FBgn0030828 Length:411 Species:Drosophila melanogaster


Alignment Length:380 Identity:115/380 - (30%)
Similarity:163/380 - (42%) Gaps:61/380 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LLAGSPI-FYSAAPRGSCSTCCA---IKER-----EDIKFMLYTSRNRNSAQLLHLSDDARLAQS 71
            |:||.|. |.|.:....||...|   ||.:     ..:.|.|.|:..:.:..|  .|.::.....
  Fly    63 LIAGYPFEFVSNSLNVICSQALASNKIKSKYSPDINKMNFQLQTACEKKNFPL--TSPESMWKSP 125

  Fly    72 NFNFNYPLAIYLHGFSESATGERQSSQELKDAFLRRGNYNVILID----------WSAMTAVPWY 126
            .|:....:.|...|::.:..|. .:.:....|:..||:.|.:.:|          |||.      
  Fly   126 LFDVKKKVVILATGWTTTVNGS-DTIEVFSKAYNCRGDVNFVAVDAARFVDTLYTWSAF------ 183

  Fly   127 SNAVENLPVSGRYLARFLRFLVDKGYPAKYIHLIGFSLGAEVAGFAGKQLQE-WGIKLPRITALD 190
                 |....|..:|..|..|:|. .|.:.|||||.||||.:.|.||:.||. ....:||||.||
  Fly   184 -----NTEEIGENIALGLVKLLDL-VPVENIHLIGHSLGAHIVGSAGRHLQHLTNQTIPRITGLD 242

  Fly   191 PALPLFEGNSSNRRLSPSDARFVDVIHTDGGLLGNPAPMGHADFYPNGGRPLQPGCAKQNIANNW 255
            ||.|.|....:...|...||.||||||::.|:||...|:|..||||.|..||..||         
  Fly   243 PAKPCFNEGEALSGLMRGDAHFVDVIHSNPGVLGKRDPVGDVDFYPGGMSPLAAGC--------- 298

  Fly   256 LGIIVGCSHQRAWEYFVESI--AQPRGFPAQRCEPSDMFGICREPGGGPAFMGMGADPRIRGKFY 318
              ..|.|:|.|:||||.|::  ...|.|.|.||.........|.| |....||......|:|.::
  Fly   299 --FSVTCAHARSWEYFAETVFPGNERNFMATRCNSISKLRDFRCP-GDEVPMGYAVPQNIKGNYF 360

  Fly   319 LDTNDAKPFGRNSRARAIV--------SLAPRLPIAYKLPPNATRQPSVSRWANG 365
            |:.:.:.|||.::   ::|        .|.|......::|...|.....| |.:|
  Fly   361 LEVSASAPFGMHA---SVVRSAHLEHCGLCPESTSTTEVPSTTTTGKPGS-WFSG 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6472NP_611166.2 Pancreat_lipase_like 43..323 CDD:238363 93/292 (32%)
CG5162NP_001285367.1 Lipase 94..369 CDD:278576 93/301 (31%)
Pancreat_lipase_like 99..365 CDD:238363 93/292 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446093
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.