DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6472 and Yp3

DIOPT Version :9

Sequence 1:NP_611166.2 Gene:CG6472 / 36895 FlyBaseID:FBgn0034166 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001285228.1 Gene:Yp3 / 32339 FlyBaseID:FBgn0004047 Length:420 Species:Drosophila melanogaster


Alignment Length:258 Identity:89/258 - (34%)
Similarity:125/258 - (48%) Gaps:32/258 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 ESATGERQSSQELKDAF--LRRGNYNVILID-WSAMTAVPWYSNAVENLPVSGRYLARFLRFLVD 149
            :|:..:..||:|..|.:  .:..:.::|:|| .|.:|....|  |:.::..:|..:.:.|..|.:
  Fly   169 KSSDYDYTSSEEAADQWKSAKAASGDLIIIDLGSTLTNFKRY--AMLDVLNTGAMIGQTLIDLTN 231

  Fly   150 KGYPAKYIHLIGFSLGAEVAGFAG-KQLQEWGIKLPRITALDPALPLFEGNSSNRRLSPSDARFV 213
            ||.|.:.|||||..:.|.|||.|| |...:.|.||.|||.||||..|.:.......||..||.||
  Fly   232 KGVPQEIIHLIGQGISAHVAGAAGNKYTAQTGHKLRRITGLDPAKVLSKRPQILGGLSRGDADFV 296

  Fly   214 DVIHTDGGLLGNPAPMGHADFYPNGGRPLQPGCAKQNIANNWLGIIVGCSHQRAWEYFVESI--A 276
            |.|||....:|.|...|..||||||.....||  .:|:..         :..||..||.||:  .
  Fly   297 DAIHTSTFAMGTPIRCGDVDFYPNGPSTGVPG--SENVIE---------AVARATRYFAESVRPG 350

  Fly   277 QPRGFPA------QRCEPSDMFGICREPGGGPAFMGMGADPRIRGKFYLDTNDAKPFGRNSRA 333
            ..|.|||      ::.:..|.|       |..|:||:..|..:||.:.|:.|...|||:.|.|
  Fly   351 SERNFPAVPANSLKQYKEQDGF-------GKRAYMGLQIDYDLRGDYILEVNAKSPFGQRSPA 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6472NP_611166.2 Pancreat_lipase_like 43..323 CDD:238363 83/246 (34%)
Yp3NP_001285228.1 Lipase 93..400 CDD:278576 84/250 (34%)
Abhydrolase <215..396 CDD:304388 71/198 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445988
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.