DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6472 and lpl

DIOPT Version :9

Sequence 1:NP_611166.2 Gene:CG6472 / 36895 FlyBaseID:FBgn0034166 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_571202.1 Gene:lpl / 30354 ZFINID:ZDB-GENE-990415-139 Length:511 Species:Danio rerio


Alignment Length:328 Identity:108/328 - (32%)
Similarity:156/328 - (47%) Gaps:52/328 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 NFNFNYPLAIYLHGFSESATGERQSSQELKDAFLRRGNYNVILIDWSAMTAVPWYSNAVENLPVS 136
            |||......|.:||::.:...|....:.:...:.|..:.|||::|        |.|.|.::.|.|
Zfish    87 NFNTETKTFIVIHGWTVTGMFESWVPKLVTALYEREPSANVIVVD--------WLSRAQQHYPTS 143

  Fly   137 GRY-------LARFLRFL-VDKGYPAKYIHLIGFSLGAEVAGFAGKQLQEWGIKLPRITALDPAL 193
            ..|       :|:|:.:| .:..||.:.:||:|:||||.|||.||...:.   |:.|||.:|||.
Zfish   144 ASYTKLVGKDVAKFVNWLQAEIDYPWEKLHLLGYSLGAHVAGIAGLLTKH---KVNRITGMDPAG 205

  Fly   194 PLFEGNSSNRRLSPSDARFVDVIHTDGGLLGNP-------APMGHADFYPNGGRPLQPGCAKQN- 250
            |.||...|...|||.||.||||:||:  ..|:|       .|:||.|.||||| ..||||..|| 
Zfish   206 PTFEYADSLSTLSPDDANFVDVLHTN--TRGSPDRSIGIQRPVGHIDIYPNGG-TFQPGCDLQNT 267

  Fly   251 ---IANNWL---GIIVGCSHQRAWEYFVESIA-QPRGFPAQRCEPSDMF--GICREPGGGPAFMG 306
               :|...|   ..||.|||:|:...|::|:. |.....|.||...|.|  |:|...........
Zfish   268 MLMVATTGLRNMDQIVKCSHERSIHLFIDSLVNQDHESMAFRCSSRDSFNKGMCLSCRKNRCNKV 332

  Fly   307 MGADPRIR----GKFYLDTNDAKPFGRNSRARAIVSLAPRLPIAYKLPPNATRQP-SVSRWA-NG 365
            ..|..:||    .|.|:.|.:..|: :....:..|....:..::|      |.|| .:|.:. :|
Zfish   333 GYAVNKIRTRRSSKMYMKTREMMPY-KVFHYQVKVHFFGKTQLSY------TDQPMKISLYGIHG 390

  Fly   366 QKE 368
            :||
Zfish   391 EKE 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6472NP_611166.2 Pancreat_lipase_like 43..323 CDD:238363 98/279 (35%)
lplNP_571202.1 lipo_lipase 52..492 CDD:132274 108/328 (33%)
Pancreat_lipase_like 56..353 CDD:238363 98/279 (35%)
PLAT 360..484 CDD:294016 9/40 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578615
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.