DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6472 and Lipc

DIOPT Version :9

Sequence 1:NP_611166.2 Gene:CG6472 / 36895 FlyBaseID:FBgn0034166 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_006243421.1 Gene:Lipc / 24538 RGDID:3009 Length:510 Species:Rattus norvegicus


Alignment Length:331 Identity:115/331 - (34%)
Similarity:162/331 - (48%) Gaps:52/331 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 EREDIKFMLYTSRNRNSAQLLHLSDDARLAQSNFNFNYPLAIYLHGF--SESAT-GERQSSQELK 101
            ::.:|:|:|:...:......|.......|.:..||.::||.:.:||:  ||||| |:...:....
  Rat    45 QKPEIRFLLFKDESDRLGCQLRPQHPETLQECGFNSSHPLVMIIHGWSGSESATVGKDSDNDSQV 109

  Fly   102 DAFLRRGNY--------------NVILIDWSAMTAVPWYSNAVENLPVSGRYLARFLRFLVDK-G 151
            |..|....:              ||.|:||.:: |...|:.||.|..|.|:.:|..|.:|.:. .
  Rat   110 DGLLETWIWKIVGALKSRQSQPVNVGLVDWISL-AYQHYAIAVRNTRVVGQEVAALLLWLEESMK 173

  Fly   152 YPAKYIHLIGFSLGAEVAGFAGKQLQEWG--IKLPRITALDPALPLFEGNSSNRRLSPSDARFVD 214
            :....:||||:||||.|:||||..:   |  .|:.|||.||||.|:|||.|.|.||||.||.|||
  Rat   174 FSRSKVHLIGYSLGAHVSGFAGSSM---GGKRKIGRITGLDPAGPMFEGTSPNERLSPDDANFVD 235

  Fly   215 VIHT-----DGGLLGNPAPMGHADFYPNGGRPLQPGC----AKQNIANNWLGII---VGCSHQRA 267
            .|||     .|..:|...|:.|.||||||| ..||||    ..::||.:.|..|   :.|:|:|:
  Rat   236 AIHTFTREHMGLSVGIKQPIAHYDFYPNGG-SFQPGCHFLELYKHIAEHGLNAITQTIKCAHERS 299

  Fly   268 WEYFVESI----AQPRGFPAQRCEPSDMF--GICREPGGGPAFMGMGAD-----PRIRGKFYLDT 321
            ...|::|:    .|..||   :|...|.|  |:|.....|.. ..:|.|     ||.....:|.|
  Rat   300 VHLFIDSLQHSNLQNTGF---QCSNMDSFSQGLCLNCKKGRC-NSLGYDIRRDRPRKSKTLFLIT 360

  Fly   322 NDAKPF 327
            ....||
  Rat   361 RAQSPF 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6472NP_611166.2 Pancreat_lipase_like 43..323 CDD:238363 113/322 (35%)
LipcXP_006243421.1 Lipase 18..366 CDD:278576 113/329 (34%)
Pancreat_lipase_like 47..362 CDD:238363 113/323 (35%)
PLAT_LPL 369..504 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339017
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.