DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6472 and LIPH

DIOPT Version :9

Sequence 1:NP_611166.2 Gene:CG6472 / 36895 FlyBaseID:FBgn0034166 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_640341.1 Gene:LIPH / 200879 HGNCID:18483 Length:451 Species:Homo sapiens


Alignment Length:344 Identity:109/344 - (31%)
Similarity:151/344 - (43%) Gaps:57/344 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ASTLCNVFTFLLAGSPIFYSAAPRGSCSTCCAIKEREDIKFMLYTSRNRNSAQLLHLSDDARLAQ 70
            |...|..||.|     .|:||          .:....:::.||||.:|...||.::.|     |.
Human    18 AEETCPSFTRL-----SFHSA----------VVGTGLNVRLMLYTRKNLTCAQTINSS-----AF 62

  Fly    71 SNFNFNYPLAIYLHGFSESATGERQS-SQELKDAFLRRGNYNVILIDWSAMTAVPWYSNAVENLP 134
            .|.|........:|||  ..||.... ..:|....|...:.||:::||:.......|::|.....
Human    63 GNLNVTKKTTFIVHGF--RPTGSPPVWMDDLVKGLLSVEDMNVVVVDWNRGATTLIYTHASSKTR 125

  Fly   135 VSGRYLARFLRFLVDKGYPAKYIHLIGFSLGAEVAGFAGKQLQEWGIKLPRITALDPALPLFEGN 199
            .....|..|:..::.:|.....|::||.||||.::||.|:....|   |.|||.||||.|||.|.
Human   126 KVAMVLKEFIDQMLAEGASLDDIYMIGVSLGAHISGFVGEMYDGW---LGRITGLDPAGPLFNGK 187

  Fly   200 SSNRRLSPSDARFVDVIHTDGGLLGNPAPMGHADFYPNGGRPLQPGCAKQNIANNWLGIIVG--- 261
            ....||.||||:||||||:|...||...|:|:.|||||||.. ||||.|         .|:|   
Human   188 PHQDRLDPSDAQFVDVIHSDTDALGYKEPLGNIDFYPNGGLD-QPGCPK---------TILGGFQ 242

  Fly   262 ---CSHQRAWEYFVESIAQPRGFPAQRCEPSDMF--GICREPGGGP----AFMGMGAD---PRIR 314
               |.|||:...::.|:.:.....|..|:....:  |.|...|...    ..:|..||   ..:|
Human   243 YFKCDHQRSVYLYLSSLRESCTITAYPCDSYQDYRNGKCVSCGTSQKESCPLLGYYADNWKDHLR 307

  Fly   315 G------KFYLDTNDAKPF 327
            |      |.:.||.:..||
Human   308 GKDPPMTKAFFDTAEESPF 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6472NP_611166.2 Pancreat_lipase_like 43..323 CDD:238363 99/301 (33%)
LIPHNP_640341.1 Pancreat_lipase_like 39..303 CDD:238363 94/283 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145335
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.