DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6472 and Pnliprp2

DIOPT Version :9

Sequence 1:NP_611166.2 Gene:CG6472 / 36895 FlyBaseID:FBgn0034166 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_476554.1 Gene:Pnliprp2 / 117554 RGDID:620793 Length:482 Species:Rattus norvegicus


Alignment Length:315 Identity:110/315 - (34%)
Similarity:154/315 - (48%) Gaps:39/315 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 DIKFMLYTSRNRNSAQLLHLSDDARLAQSNFNFNYPLAIYLHGFSESATGERQSSQELKDAFLRR 107
            |.:|:|||:.|.|:.|.:..::...:..|||..:......:|||.:.  ||.....::.....:.
  Rat    66 DTRFLLYTNENPNNYQKISATEPDTIKFSNFQLDRKTRFIVHGFIDK--GEDGWLLDMCKKMFQV 128

  Fly   108 GNYNVILIDWSAMTAVPWYSNAVENLPVSGRYLARFLRFL-VDKGYPAKYIHLIGFSLGAEVAGF 171
            ...|.|.:||...:... |:.|..|..|.|..:|..::.| .:.||..:.:||||.||||.|.|.
  Rat   129 EKVNCICVDWRRGSRTE-YTQASYNTRVVGAEIAFLVQVLSTEMGYSPENVHLIGHSLGAHVVGE 192

  Fly   172 AGKQLQEWGIKLPRITALDPALPLFEGNSSNRRLSPSDARFVDVIHTDGGLL------GNPAPMG 230
            ||::|:.   .:.|||.||||.|.|:|.....||.||||.||||||||...:      |....:|
  Rat   193 AGRRLEG---HVGRITGLDPAEPCFQGLPEEVRLDPSDAMFVDVIHTDSAPIIPYLGFGMSQKVG 254

  Fly   231 HADFYPNGGRPLQPGCAKQ------NIANNWLGI--IVGCSHQRAWEYFVESIAQPRGFPAQRC- 286
            |.||:||||:.: |||.|.      :|...|.|.  .|.|:|.|:::|:..||..|.||....| 
  Rat   255 HLDFFPNGGKEM-PGCQKNILSTIVDINGIWEGTQNFVACNHLRSYKYYASSILNPDGFLGYPCS 318

  Fly   287 -----EPSDMFGICREPGGGPAFMGMGADPRIRGK-------FYLDTNDAKPFGR 329
                 :.:|.|. |  |..|...||..|| :..||       .||:|.|:..|.|
  Rat   319 SYEKFQQNDCFP-C--PEEGCPKMGHYAD-QFEGKTATVEQTVYLNTGDSGNFTR 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6472NP_611166.2 Pancreat_lipase_like 43..323 CDD:238363 107/307 (35%)
Pnliprp2NP_476554.1 Lipase 31..367 CDD:278576 108/311 (35%)
Pancreat_lipase_like 65..363 CDD:238363 107/307 (35%)
PLAT_PL 370..482 CDD:238857 110/315 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339021
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.