DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6472 and LOC101884800

DIOPT Version :9

Sequence 1:NP_611166.2 Gene:CG6472 / 36895 FlyBaseID:FBgn0034166 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_005174466.1 Gene:LOC101884800 / 101884800 -ID:- Length:530 Species:Danio rerio


Alignment Length:340 Identity:115/340 - (33%)
Similarity:165/340 - (48%) Gaps:43/340 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LLAGSPIFYSAAPRGSCSTCCAIKEREDI--KFMLYTSR--NRNSAQLLHLSDDARLAQSNFNFN 76
            |:|..|||.|.....:.:    ..:..||  ||.:.:..  :.:...|:....|: ::..||..:
Zfish    15 LIASEPIFNSTEEAFASN----FTDYSDIESKFSIRSVEFPDEDLCYLVPGQQDS-ISDCNFKND 74

  Fly    77 YPLAIYLHGFSESATGERQSSQELKDAFLRRGNYNVILIDWSAMTAVPWYSNAVENLPVSGRYLA 141
            ....:.:||:|.:...|....:.:...:.|..:.|||::|| ...|...|..:.||..:.|..:|
Zfish    75 SQTFLIIHGWSVAGLFESWVYKLVTALYDREPSANVIVVDW-LDRANKHYPKSAENTRLVGADVA 138

  Fly   142 RFLRFLVDKGYPAKYIHLIGFSLGAEVAGFAGKQLQEWGIKLPRITALDPALPLFEGNSSNRRLS 206
            :|:.:|.:..||.:.:||:|:||||.|||.||.....   |:.|||.||||.|.||.....||||
Zfish   139 KFVNWLEELDYPLEKVHLLGYSLGAHVAGVAGNLTNN---KVHRITGLDPAGPSFENADILRRLS 200

  Fly   207 PSDARFVDVIHTDGGLLGNP-------APMGHADFYPNGGRPLQPGCAKQN----IANNWLGI-- 258
            |.||.||||:||:  ..|:|       .|:||.|.||||| ..||||:.|:    ||.  .||  
Zfish   201 PDDASFVDVLHTN--TRGSPDLSIGIQRPVGHVDIYPNGG-TFQPGCSIQHTMKLIAT--CGIYN 260

  Fly   259 ---IVGCSHQRAWEYFVESIA-QPRGFPAQRCEPSDMF--GICREPGGGPA-FMGMGADPRIRG- 315
               ||.|||:|:...|::|:. |.....|.||...|.|  |:|........ .:|... .:||. 
Zfish   261 MDQIVKCSHERSIHLFIDSLVNQAYQSWAFRCASRDSFNKGLCLSCRKNRCNTLGYNV-KKIRST 324

  Fly   316 ---KFYLDTNDAKPF 327
               |.||.|.:..||
Zfish   325 RSTKMYLKTREMMPF 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6472NP_611166.2 Pancreat_lipase_like 43..323 CDD:238363 107/307 (35%)
LOC101884800XP_005174466.1 lipo_lipase 35..473 CDD:132274 109/316 (34%)
Pancreat_lipase_like 39..335 CDD:238363 106/306 (35%)
PLAT 342..464 CDD:294016
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578616
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.