DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6472 and LOC100489174

DIOPT Version :9

Sequence 1:NP_611166.2 Gene:CG6472 / 36895 FlyBaseID:FBgn0034166 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_031762470.1 Gene:LOC100489174 / 100489174 -ID:- Length:471 Species:Xenopus tropicalis


Alignment Length:300 Identity:109/300 - (36%)
Similarity:149/300 - (49%) Gaps:27/300 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 EREDIKFMLYTSRNRNSAQLLHLSDDARLAQSNFNFNYPLAIYLHGFSESATGERQSSQELKDAF 104
            |..:.:|.|:|.:|....|::...:...:..|.|..|......:||....|  |.....::..|.
 Frog    59 EEINTRFFLHTRQNPKQHQIISAQNVTGIGASAFQTNQNSTFIVHGMGHKA--ENNWVSDMCKAI 121

  Fly   105 LRRGNYNVILIDWSAMTA-VPWYSNAVENLPVSGRYLARFLRFL-VDKGYPAKYIHLIGFSLGAE 167
            |...:.|.|.:||...:. :..|..|..|..:.|..:|..|:.| .:.||||..:|:||.||||.
 Frog   122 LEAEDVNCIGVDWREGSGNIKMYVQAANNARLVGAEIAYLLQVLQTEYGYPASKVHVIGHSLGAH 186

  Fly   168 VAGFAGKQLQEWGIKLPRITALDPALPLFEGNSSNRRLSPSDARFVDVIHTDGGL---LGNPAPM 229
            .||.|||:.|  ||:  |||.||||..|||......||.||||.||||||||...   :|...|:
 Frog   187 AAGEAGKRHQ--GIR--RITGLDPAKQLFEDTPEEVRLDPSDAGFVDVIHTDISFPLGVGIVKPI 247

  Fly   230 GHADFYPNGGRPLQPGC-AKQNIANNWLGII--VGCSHQRAWEYFVESIAQPRGFPAQRCEPSDM 291
            ||.|||||||:.: ||| .|.:...|...::  :.|:|.||:.|:.|||.:..||....|:....
 Frog   248 GHLDFYPNGGKNM-PGCPPKLSDLGNMDALVDTLTCNHFRAFLYYTESIRRREGFLGYPCDSYKS 311

  Fly   292 F--GI---CREPGGGPAFMGMGAD--PRIRGK---FYLDT 321
            |  |.   |  |.|...|||..:.  |.::..   |||:|
 Frog   312 FLSGASFPC--PEGRCTFMGHYSQLPPALKAPQQIFYLNT 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6472NP_611166.2 Pancreat_lipase_like 43..323 CDD:238363 107/296 (36%)
LOC100489174XP_031762470.1 Lipase 28..352 CDD:395099 108/299 (36%)
PLAT 359..471 CDD:412108
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.