DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6472 and lipib

DIOPT Version :9

Sequence 1:NP_611166.2 Gene:CG6472 / 36895 FlyBaseID:FBgn0034166 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_001342691.1 Gene:lipib / 100003046 ZFINID:ZDB-GENE-091118-47 Length:448 Species:Danio rerio


Alignment Length:306 Identity:94/306 - (30%)
Similarity:134/306 - (43%) Gaps:33/306 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 IKFMLYTSRNRNSAQLLHLSDDARLAQSNFNFNYPLAIYLHGFSESATGERQS-SQELKDAFLRR 107
            ::.:|||..|....|  .|.......|..||...|....:||:  ..||.... ...:......:
Zfish    42 VRLLLYTRANLECGQ--ELPHHNFTQQPLFNVTRPTTFVIHGY--RPTGAPPIWINHIVHLLAAQ 102

  Fly   108 GNYNVILIDWSAMTAVPWYSNAVENLPVSGRYLARFLRFLVDKGYPAKYIHLIGFSLGAEVAGFA 172
            .:.|::::||:...|...|..||.|...:...:.||:..:..:|.....|||||.||||.||||.
Zfish   103 KDMNILVVDWNRGAANLNYLTAVANTRGTALNITRFIESMEKEGASLDSIHLIGVSLGAHVAGFI 167

  Fly   173 GKQLQEWGIKLPRITALDPALPLFEGNSSNRRLSPSDARFVDVIHTDGGLLGNPAPMGHADFYPN 237
            |..|   |.::.|||.||||.|:|...|...||.|:||:||||:|||....|.....||.|||.|
Zfish   168 GAML---GGRVGRITGLDPAGPMFASVSPEERLDPTDAQFVDVLHTDMNSFGLRGTHGHIDFYAN 229

  Fly   238 GGRPLQPGCAKQNIANNWLGIIVGCSHQRAWEYFVESIAQP---RGFPAQ--------RCEPSDM 291
            ||.. ||||.|...:.....:   |.|||:...::.|:.:.   .|:|..        :|...:.
Zfish   230 GGLD-QPGCPKTIFSGKSYFV---CDHQRSVFLYLCSLNRTCSLTGYPCSSYSDFLSGQCLQCET 290

  Fly   292 FGICREPGGGPAF---MGMGADPRIR---GKFYLDTNDAKPFGRNS 331
            |    :|...|..   :....|..:|   .:.|..|....|:.:.|
Zfish   291 F----KPASCPVLGYDLSQWRDTLLRLGQTRAYFSTTAELPYSKTS 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6472NP_611166.2 Pancreat_lipase_like 43..323 CDD:238363 92/296 (31%)
lipibXP_001342691.1 Lipase 37..328 CDD:278576 92/300 (31%)
Pancreat_lipase_like 40..324 CDD:238363 92/296 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578551
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.