DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6435 and CG6421

DIOPT Version :9

Sequence 1:NP_611165.2 Gene:CG6435 / 36894 FlyBaseID:FBgn0034165 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_652048.2 Gene:CG6421 / 46813 FlyBaseID:FBgn0025827 Length:161 Species:Drosophila melanogaster


Alignment Length:157 Identity:83/157 - (52%)
Similarity:102/157 - (64%) Gaps:11/157 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLVCLWLLVYSGSSY-----EVQNKPVTEDCLDCLCETMSGCNASAICVN---GACGIFRITWGY 60
            ||..::||:....|.     .|.:|||||.||.|:||.:|||||:|||.:   ||||||||||||
  Fly     5 LLYSIYLLLVLSPSLVQGQGHVLDKPVTELCLTCICEAISGCNATAICTSAEKGACGIFRITWGY 69

  Fly    61 WVEAGKLTLPTDTALSEDAFTNCVNQPHCAANTVQNYMFKHGQDCNGDEHIDCLDFGALHKLGNL 125
            ||:|||||:..:...||.||.||...|||||:.|||||.|..||||.|..:||.|:..:||||..
  Fly    70 WVDAGKLTVNGEHPDSEKAFINCAKDPHCAADLVQNYMKKFNQDCNDDGEMDCHDYARIHKLGAY 134

  Fly   126 KCQEELPYIFAKVFNRCLKSKERMAEE 152
            .||.::||.|..||..|:   ||..:|
  Fly   135 GCQADMPYNFQSVFEECI---ERYEDE 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6435NP_611165.2 Destabilase 26..142 CDD:283215 70/118 (59%)
CG6421NP_652048.2 Destabilase 32..151 CDD:283215 70/118 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453878
Domainoid 1 1.000 66 1.000 Domainoid score I6517
eggNOG 1 0.900 - - E1_2DQ45
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I3946
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D110487at33392
OrthoFinder 1 1.000 - - FOG0009988
OrthoInspector 1 1.000 - - otm14605
orthoMCL 1 0.900 - - OOG6_109484
Panther 1 1.100 - - P PTHR11195
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.