DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6435 and ilys-4

DIOPT Version :9

Sequence 1:NP_611165.2 Gene:CG6435 / 36894 FlyBaseID:FBgn0034165 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_001379820.1 Gene:ilys-4 / 183853 WormBaseID:WBGene00016958 Length:159 Species:Caenorhabditis elegans


Alignment Length:138 Identity:33/138 - (23%)
Similarity:55/138 - (39%) Gaps:15/138 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLRLLVCLWLLVYSGSSYEVQNKPVTED--CLDCLCETMSGCNASAICVNG----ACGIFRIT-- 57
            ||.:.|.:..|:.|.:...:....|.:|  ||..:|:..|||......|:.    .||.||:.  
 Worm     1 MLIVTVTVISLLVSVTHQLLMFDKVEDDHPCLLAMCDQDSGCVPLGCSVDQFDRIGCGYFRLNIY 65

  Fly    58 -WGYWVEAGKLTLPTDTALSEDAFTNCVNQPHCAANTVQNYMFKHGQDCNGDEHIDCLDFGALHK 121
             :....:.||    .|.....:|:.||.....|:|:.::....|....|.|..  :|.....:|.
 Worm    66 QFQQCYQPGK----KDEDTENEAWMNCAQDYQCSASCIRTLATKFRVKCYGKS--ECETIARIHD 124

  Fly   122 LGNLKCQE 129
            .|...|::
 Worm   125 GGANGCRD 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6435NP_611165.2 Destabilase 26..142 CDD:283215 27/113 (24%)
ilys-4NP_001379820.1 lyz_i 30..146 CDD:381611 26/109 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161271
Domainoid 1 1.000 66 1.000 Domainoid score I6517
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I3946
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1343143at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11195
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
77.050

Return to query results.
Submit another query.