DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6435 and ilys-5

DIOPT Version :9

Sequence 1:NP_611165.2 Gene:CG6435 / 36894 FlyBaseID:FBgn0034165 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_001024594.1 Gene:ilys-5 / 180928 WormBaseID:WBGene00017691 Length:139 Species:Caenorhabditis elegans


Alignment Length:109 Identity:34/109 - (31%)
Similarity:51/109 - (46%) Gaps:22/109 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VTEDCLDCLCETMSGCNASAICVNG---ACGIFRITWGYWVEAGKLTLPTDTA--LSEDAFTNCV 84
            |:.|||.|:|...|||......::.   :||.::|..||:.:.|:   ||..|  .:|.|:..|.
 Worm    16 VSADCLHCICMRESGCKPIGCHMDVGSLSCGYYQIKIGYYEDCGQ---PTKKAGETTEAAWKRCA 77

  Fly    85 NQPHCAANTVQNYMFKHGQDCNGDEHIDCLDFGALHKLGNLKCQ 128
            :..:||...|:||..::...|||      |..||        ||
 Worm    78 DDLNCATTCVENYYNRYKSQCNG------LGMGA--------CQ 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6435NP_611165.2 Destabilase 26..142 CDD:283215 33/108 (31%)
ilys-5NP_001024594.1 Destabilase 17..135 CDD:283215 33/108 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I6517
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I3946
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46392
OrthoDB 1 1.010 - - D1343143at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14375
orthoMCL 1 0.900 - - OOG6_109484
Panther 1 1.100 - - O PTHR11195
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.980

Return to query results.
Submit another query.