DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6429 and CG6435

DIOPT Version :9

Sequence 1:NP_611164.3 Gene:CG6429 / 36893 FlyBaseID:FBgn0046999 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_611165.2 Gene:CG6435 / 36894 FlyBaseID:FBgn0034165 Length:163 Species:Drosophila melanogaster


Alignment Length:143 Identity:76/143 - (53%)
Similarity:107/143 - (74%) Gaps:7/143 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VGIWV------QAEVQ-KPITEQCLICMCEALSGCNATAVCVNGACGIFRITWDQWVDSGRLTIP 73
            |.:|:      ..||| ||:||.||.|:||.:|||||:|:|||||||||||||..||::|:||:|
  Fly     6 VCLWLLVYSGSSYEVQNKPVTEDCLDCLCETMSGCNASAICVNGACGIFRITWGYWVEAGKLTLP 70

  Fly    74 GDSPLTDSSFTNCANDPYCAADTLQSYMVKYGQDCNDDQKEDCYDYGAIHYMGPFNCKADMPYTY 138
            .|:.|::.:||||.|.|:|||:|:|:||.|:|||||.|:..||.|:||:|.:|...|:.::||.:
  Fly    71 TDTALSEDAFTNCVNQPHCAANTVQNYMFKHGQDCNGDEHIDCLDFGALHKLGNLKCQEELPYIF 135

  Fly   139 ESIFKRCLRNAMR 151
            ..:|.|||::..|
  Fly   136 AKVFNRCLKSKER 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6429NP_611164.3 Destabilase 29..145 CDD:283215 65/115 (57%)
CG6435NP_611165.2 Destabilase 26..142 CDD:283215 65/115 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453879
Domainoid 1 1.000 66 1.000 Domainoid score I6517
eggNOG 1 0.900 - - E1_2DQ45
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I3946
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D110487at33392
OrthoFinder 1 1.000 - - FOG0009988
OrthoInspector 1 1.000 - - otm14605
orthoMCL 1 0.900 - - OOG6_109484
Panther 1 1.100 - - P PTHR11195
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.