powered by:
Protein Alignment CG6429 and ilys-1
DIOPT Version :9
Sequence 1: | NP_611164.3 |
Gene: | CG6429 / 36893 |
FlyBaseID: | FBgn0046999 |
Length: | 159 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_500208.2 |
Gene: | ilys-1 / 183474 |
WormBaseID: | WBGene00016668 |
Length: | 73 |
Species: | Caenorhabditis elegans |
Alignment Length: | 50 |
Identity: | 13/50 - (26%) |
Similarity: | 23/50 - (46%) |
Gaps: | 3/50 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 98 QSYMVKYGQDCNDDQKEDCYDYGAIHYMGPFNCK--ADMPYTYESIFKRC 145
::|..:|...|:.....:|..:...|..||..|: ..:.| ::||.|.|
Worm 21 ENYYHRYKSQCDGLGMGECEVFARNHNGGPTGCRNPGTLEY-WQSIQKCC 69
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR11195 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.