DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6429 and ilys-1

DIOPT Version :9

Sequence 1:NP_611164.3 Gene:CG6429 / 36893 FlyBaseID:FBgn0046999 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_500208.2 Gene:ilys-1 / 183474 WormBaseID:WBGene00016668 Length:73 Species:Caenorhabditis elegans


Alignment Length:50 Identity:13/50 - (26%)
Similarity:23/50 - (46%) Gaps:3/50 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 QSYMVKYGQDCNDDQKEDCYDYGAIHYMGPFNCK--ADMPYTYESIFKRC 145
            ::|..:|...|:.....:|..:...|..||..|:  ..:.| ::||.|.|
 Worm    21 ENYYHRYKSQCDGLGMGECEVFARNHNGGPTGCRNPGTLEY-WQSIQKCC 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6429NP_611164.3 Destabilase 29..145 CDD:283215 12/48 (25%)
ilys-1NP_500208.2 Destabilase <21..68 CDD:283215 11/47 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11195
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.