DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6426 and CG6421

DIOPT Version :9

Sequence 1:NP_611163.2 Gene:CG6426 / 36891 FlyBaseID:FBgn0034162 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_652048.2 Gene:CG6421 / 46813 FlyBaseID:FBgn0025827 Length:161 Species:Drosophila melanogaster


Alignment Length:146 Identity:77/146 - (52%)
Similarity:99/146 - (67%) Gaps:7/146 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLCLGFAALIQAQ----DKPVTDVCLGCICEAISGCNQTRYCGG---GVCGLFRITWAYWADGGK 72
            ||.:...:|:|.|    |||||::||.||||||||||.|..|..   |.||:|||||.||.|.||
  Fly    11 LLLVLSPSLVQGQGHVLDKPVTELCLTCICEAISGCNATAICTSAEKGACGIFRITWGYWVDAGK 75

  Fly    73 LTLGNESPQSEDAYANCVNDPYCAANTIQNYMTKFGQDCNGDNAIDCYDFAAIHKLGGYGCKGEL 137
            ||:..|.|.||.|:.||..||:|||:.:||||.||.||||.|..:||:|:|.|||||.|||:.::
  Fly    76 LTVNGEHPDSEKAFINCAKDPHCAADLVQNYMKKFNQDCNDDGEMDCHDYARIHKLGAYGCQADM 140

  Fly   138 SYQYQTQLTNCLNSFQ 153
            .|.:|:....|:..::
  Fly   141 PYNFQSVFEECIERYE 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6426NP_611163.2 Destabilase 32..148 CDD:283215 67/118 (57%)
CG6421NP_652048.2 Destabilase 32..151 CDD:283215 67/118 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453881
Domainoid 1 1.000 66 1.000 Domainoid score I6517
eggNOG 1 0.900 - - E1_2DQ45
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I3946
Isobase 1 0.950 - 0 Normalized mean entropy S12255
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D110487at33392
OrthoFinder 1 1.000 - - FOG0009988
OrthoInspector 1 1.000 - - otm14605
orthoMCL 1 0.900 - - OOG6_109484
Panther 1 1.100 - - P PTHR11195
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
1110.750

Return to query results.
Submit another query.