DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6426 and CG6429

DIOPT Version :9

Sequence 1:NP_611163.2 Gene:CG6426 / 36891 FlyBaseID:FBgn0034162 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_611164.3 Gene:CG6429 / 36893 FlyBaseID:FBgn0046999 Length:159 Species:Drosophila melanogaster


Alignment Length:148 Identity:71/148 - (47%)
Similarity:101/148 - (68%) Gaps:2/148 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLCLGFAAL-IQAQ-DKPVTDVCLGCICEAISGCNQTRYCGGGVCGLFRITWAYWADGGKLTLGN 77
            :|.|.|..: :||: .||:|:.||.|:|||:||||.|..|..|.||:|||||..|.|.|:||:..
  Fly    10 VLGLTFVGIWVQAEVQKPITEQCLICMCEALSGCNATAVCVNGACGIFRITWDQWVDSGRLTIPG 74

  Fly    78 ESPQSEDAYANCVNDPYCAANTIQNYMTKFGQDCNGDNAIDCYDFAAIHKLGGYGCKGELSYQYQ 142
            :||.::.::.||.|||||||:|:|:||.|:|||||.|...||||:.|||.:|.:.||.::.|.|:
  Fly    75 DSPLTDSSFTNCANDPYCAADTLQSYMVKYGQDCNDDQKEDCYDYGAIHYMGPFNCKADMPYTYE 139

  Fly   143 TQLTNCLNSFQQIDVRSS 160
            :....||.:..:.|.|.:
  Fly   140 SIFKRCLRNAMRNDKRQN 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6426NP_611163.2 Destabilase 32..148 CDD:283215 60/115 (52%)
CG6429NP_611164.3 Destabilase 29..145 CDD:283215 60/115 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453883
Domainoid 1 1.000 66 1.000 Domainoid score I6517
eggNOG 1 0.900 - - E1_2DQ45
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I3946
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D110487at33392
OrthoFinder 1 1.000 - - FOG0009988
OrthoInspector 1 1.000 - - otm14605
orthoMCL 1 0.900 - - OOG6_109484
Panther 1 1.100 - - P PTHR11195
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.