DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6426 and ilys-4

DIOPT Version :9

Sequence 1:NP_611163.2 Gene:CG6426 / 36891 FlyBaseID:FBgn0034162 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_001379820.1 Gene:ilys-4 / 183853 WormBaseID:WBGene00016958 Length:159 Species:Caenorhabditis elegans


Alignment Length:126 Identity:40/126 - (31%)
Similarity:56/126 - (44%) Gaps:29/126 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DKPVTDVCLGCICEAISGC-------NQTRYCGGGVCGLFRITWAY-----WADGGKLTLGNESP 80
            |.|    ||..:|:..|||       :|....|   ||.||:. .|     :..|.|    :|..
 Worm    28 DHP----CLLAMCDQDSGCVPLGCSVDQFDRIG---CGYFRLN-IYQFQQCYQPGKK----DEDT 80

  Fly    81 QSEDAYANCVNDPYCAANTIQNYMTKFGQDCNGDNAIDCYDFAAIHKLGGYGC--KGELSY 139
            ::| |:.||..|..|:|:.|:...|||...|.|.:  :|...|.||..|..||  :|.:.|
 Worm    81 ENE-AWMNCAQDYQCSASCIRTLATKFRVKCYGKS--ECETIARIHDGGANGCRDRGTIGY 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6426NP_611163.2 Destabilase 32..148 CDD:283215 38/122 (31%)
ilys-4NP_001379820.1 lyz_i 30..146 CDD:381611 39/124 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I6517
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I3946
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1343143at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11195
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
77.030

Return to query results.
Submit another query.