DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6426 and ilys-5

DIOPT Version :9

Sequence 1:NP_611163.2 Gene:CG6426 / 36891 FlyBaseID:FBgn0034162 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_001024594.1 Gene:ilys-5 / 180928 WormBaseID:WBGene00017691 Length:139 Species:Caenorhabditis elegans


Alignment Length:141 Identity:40/141 - (28%)
Similarity:58/141 - (41%) Gaps:12/141 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IGALLCLGFAALIQAQDKPVTDVCLGCICEAISGCNQTRYC----GGGVCGLFRITWAYWADGGK 72
            :.:||.|..|....:.|      ||.|||...|||.... |    |...||.::|...|:.|.|:
 Worm     3 VKSLLLLSVAIAYVSAD------CLHCICMRESGCKPIG-CHMDVGSLSCGYYQIKIGYYEDCGQ 60

  Fly    73 LTLGNESPQSEDAYANCVNDPYCAANTIQNYMTKFGQDCNGDNAIDCYDFAAIHKLGGYGCKGEL 137
            .| ......:|.|:..|.:|..||...::||..::...|||.....|...:..|..|..||....
 Worm    61 PT-KKAGETTEAAWKRCADDLNCATTCVENYYNRYKSQCNGLGMGACQIMSRNHNGGPRGCHNAN 124

  Fly   138 SYQYQTQLTNC 148
            :..|...:.:|
 Worm   125 TLAYWNGVKSC 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6426NP_611163.2 Destabilase 32..148 CDD:283215 34/119 (29%)
ilys-5NP_001024594.1 Destabilase 17..135 CDD:283215 35/125 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161270
Domainoid 1 1.000 66 1.000 Domainoid score I6517
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I3946
Isobase 1 0.950 - 0 Normalized mean entropy S12255
OMA 1 1.010 - - QHG46392
OrthoDB 1 1.010 - - D1343143at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14375
orthoMCL 1 0.900 - - OOG6_109484
Panther 1 1.100 - - LDO PTHR11195
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.860

Return to query results.
Submit another query.