DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6426 and ilys-6

DIOPT Version :9

Sequence 1:NP_611163.2 Gene:CG6426 / 36891 FlyBaseID:FBgn0034162 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_500470.2 Gene:ilys-6 / 177164 WormBaseID:WBGene00020982 Length:138 Species:Caenorhabditis elegans


Alignment Length:143 Identity:43/143 - (30%)
Similarity:62/143 - (43%) Gaps:24/143 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KLCCTLAIGALLCLGFAALIQAQDKPVTDVCLGCICEAIS-----GCNQTRYCGGGVCGLFRITW 64
            |||..||        ||....:.|      ||.|||:..|     |||..  .|...||.::|..
 Worm     4 KLCGILA--------FAVTYASSD------CLQCICKKESECKPVGCNDD--VGSLSCGYYQIKL 52

  Fly    65 AYWADGGKLTLGNESPQS-EDAYANCVNDPYCAANTIQNYMTKFGQDCNGDNAIDCYDFAAIHKL 128
            :|:.|.|:  .|..:.:| |.|:..|.::..||:..:|:|..::.:.|.|.....|...|..|..
 Worm    53 SYYKDCGQ--PGKRAGESVEAAWRRCSDELDCASTCVQSYYNRYKKQCAGTGQGACEIMARNHNG 115

  Fly   129 GGYGCKGELSYQY 141
            |..|||...:..|
 Worm   116 GPRGCKKSATLGY 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6426NP_611163.2 Destabilase 32..148 CDD:283215 35/116 (30%)
ilys-6NP_500470.2 Destabilase 17..133 CDD:310240 36/122 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I6517
eggNOG 1 0.900 - - E1_2DQ45
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I3946
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46392
OrthoDB 1 1.010 - - D1343143at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14502
orthoMCL 1 0.900 - - OOG6_109484
Panther 1 1.100 - - O PTHR11195
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.840

Return to query results.
Submit another query.