DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6426 and ilys-3

DIOPT Version :9

Sequence 1:NP_611163.2 Gene:CG6426 / 36891 FlyBaseID:FBgn0034162 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_500206.1 Gene:ilys-3 / 177033 WormBaseID:WBGene00016670 Length:139 Species:Caenorhabditis elegans


Alignment Length:141 Identity:41/141 - (29%)
Similarity:58/141 - (41%) Gaps:12/141 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IGALLCLGFAALIQAQDKPVTDVCLGCICEAISGCNQTRYC----GGGVCGLFRITWAYWADGGK 72
            :.:|:.|..|....:.|      ||.|||...|||.... |    |...||.::|...|:.|.|:
 Worm     3 VKSLVFLTIAVAYASAD------CLHCICMRESGCKPIG-CNMDVGSLSCGYYQIKLPYYEDCGQ 60

  Fly    73 LTLGNESPQSEDAYANCVNDPYCAANTIQNYMTKFGQDCNGDNAIDCYDFAAIHKLGGYGCKGEL 137
            .| ......:|.|:..|.||..||...::||..::...|.|.....|...|..|..|..|||...
 Worm    61 PT-KKSGETTEAAWKRCANDLSCATTCVENYYNRYKSQCAGTGQGACEVMARNHNGGPQGCKHSG 124

  Fly   138 SYQYQTQLTNC 148
            :..|...:.:|
 Worm   125 TLGYWNGIKSC 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6426NP_611163.2 Destabilase 32..148 CDD:283215 36/119 (30%)
ilys-3NP_500206.1 Destabilase 17..135 CDD:310240 37/125 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I6517
eggNOG 1 0.900 - - E1_2DQ45
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I3946
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46392
OrthoDB 1 1.010 - - D1343143at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14605
orthoMCL 1 0.900 - - OOG6_109484
Panther 1 1.100 - - O PTHR11195
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.840

Return to query results.
Submit another query.