DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and Angpt2

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_604449.1 Gene:Angpt2 / 89805 RGDID:621861 Length:496 Species:Rattus norvegicus


Alignment Length:246 Identity:77/246 - (31%)
Similarity:118/246 - (47%) Gaps:22/246 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LFYLASAEIGENVKIQTYKKYS-SSCKELNPKKSGVQKIQV-------GSDVIEVYCDVTIAGKG 71
            |..::|.:...:|.:...:|.: ..|.|:  .|||:....:       .::.::.|||:.:.|.|
  Rat   259 LTMMSSPDYKSSVAVPKEEKTTFRDCAEI--FKSGLTTSGIYTLTFPNSTEEVKAYCDMDMGGGG 321

  Fly    72 WLVVQRRVSVEENFYRNWTSYQTGFGDLKGNFFIGLNNLNKISSLQPQELYIELVDFAGEKRYAH 136
            |.|:|.|.....:|.|.|..|:.|||...|.:::|...:::::|.....|.|:|.|:.|.:.::.
  Rat   322 WTVIQHREDGSVDFQRTWKEYKEGFGSPLGEYWLGNEFVSQLTSGHRYVLKIQLKDWEGSEAHSL 386

  Fly   137 YSVFHVGNVYSNYPITQLGAYSGTAGDSLSYHLYQP---FSTFDRDNDNATINCAARYMGAWWYR 198
            |..|::....|||.| .|...:||||...|  :.||   |||.|.|||.....|:....|.||:.
  Rat   387 YEHFYLSGEESNYRI-HLTGLTGTAGKISS--ISQPGSDFSTKDSDNDKCICKCSQMLTGGWWFD 448

  Fly   199 ECLSRIPCSNLNGAYLGGNHTDPALFGSGIVWGEWKGFTYSYKTVNIMVRP 249
            .|    ..|||||.|..........  :||.|..|||..||.|...:|:||
  Rat   449 AC----GPSNLNGQYYPQKQNTNKF--NGIKWYYWKGSGYSLKATTMMIRP 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 74/227 (33%)
Angpt2NP_604449.1 Mplasa_alph_rch <78..>232 CDD:275316
FBG 280..494 CDD:214548 73/225 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.