DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and FCN3

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_003656.2 Gene:FCN3 / 8547 HGNCID:3625 Length:299 Species:Homo sapiens


Alignment Length:232 Identity:85/232 - (36%)
Similarity:130/232 - (56%) Gaps:13/232 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 EIGENVKIQTYKKYSSSCKEL---NPKKSGVQKIQVGSD-VIEVYCDVTIAGKGWLVVQRRVSVE 82
            |.|:.|.:...::...:|:||   ....||...:.:... .:.|:||:...|.||||.|||....
Human    76 EPGDPVNLLRCQEGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGS 140

  Fly    83 ENFYRNWTSYQTGFGDLKGNFFIGLNNLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYS 147
            .:|:|:|:||:.|||:.:..|::|..||::::.....||.:||.||.|.:.:|||:.|.:.....
Human   141 VDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVD 205

  Fly   148 NYPITQLGAYS-GTAGDSLSYHLYQPFSTFDRDNDNATINCAARYMGAWWYRECLSRIPCSNLNG 211
            :|.:. ||.:| ||||||||.|..:||:|:|.|:|::..|||....|||||..|..    |||||
Human   206 HYQLA-LGKFSEGTAGDSLSLHSGRPFTTYDADHDSSNSNCAVIVHGAWWYASCYR----SNLNG 265

  Fly   212 AYLGGNHTDPALFGSGIVWGEWKGFTYSYKTVNIMVR 248
            .|.   .::.|....||.|...:|..:.|:.|.:|:|
Human   266 RYA---VSEAAAHKYGIDWASGRGVGHPYRRVRMMLR 299

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 82/220 (37%)
FCN3NP_003656.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..81 2/4 (50%)
FReD 90..299 CDD:238040 81/216 (38%)