Sequence 1: | NP_001246376.1 | Gene: | CG5550 / 36883 | FlyBaseID: | FBgn0034160 | Length: | 250 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001138578.1 | Gene: | FIBCD1 / 84929 | HGNCID: | 25922 | Length: | 461 | Species: | Homo sapiens |
Alignment Length: | 196 | Identity: | 85/196 - (43%) |
---|---|---|---|
Similarity: | 114/196 - (58%) | Gaps: | 15/196 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 60 EVYCDVTIAGKGWLVVQRRVSVEENFYRNWTSYQTGFGDLKGNFFIGLNNLNKISSLQPQELYIE 124
Fly 125 LVDFAGEKRYAHYSVFHVGNVYS------NYPITQLGAYSGTAGDSLSYHLYQPFSTFDRDNDNA 183
Fly 184 TINCAARYMGAWWYRECLSRIPCSNLNGAYLGGNHTDPALFGSGIVWGEWKGFTYSYKTVNIMVR 248
Fly 249 P 249 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5550 | NP_001246376.1 | FReD | 34..250 | CDD:238040 | 85/196 (43%) |
FIBCD1 | NP_001138578.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..24 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 214..238 | ||||
FReD | 241..457 | CDD:238040 | 85/196 (43%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG2579 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 188 | 1.000 | Inparanoid score | I3915 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000029 | |
OrthoInspector | 1 | 1.000 | - | - | otm40314 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR19143 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X25 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
7 | 6.960 |