DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and FIBCD1

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001138578.1 Gene:FIBCD1 / 84929 HGNCID:25922 Length:461 Species:Homo sapiens


Alignment Length:196 Identity:85/196 - (43%)
Similarity:114/196 - (58%) Gaps:15/196 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 EVYCDVTIAGKGWLVVQRRVSVEENFYRNWTSYQTGFGDLKGNFFIGLNNLNKISSLQPQELYIE 124
            :||||:...|.||.|.|||.....||:|.|.:|:.|||.|.|..::||..::.:::....||:::
Human   270 QVYCDMRTDGGGWTVFQRREDGSVNFFRGWDAYRDGFGRLTGEHWLGLKRIHALTTQAAYELHVD 334

  Fly   125 LVDFAGEKRYAHYSVFHVGNVYS------NYPITQLGAYSGTAGDSLSYHLYQPFSTFDRDNDNA 183
            |.||.....||.|..|.|| ::|      .||:| :..|||||||||..|....|:|.|||:|::
Human   335 LEDFENGTAYARYGSFGVG-LFSVDPEEDGYPLT-VADYSGTAGDSLLKHSGMRFTTKDRDSDHS 397

  Fly   184 TINCAARYMGAWWYRECLSRIPCSNLNGAYLGGNHTDPALFGSGIVWGEWKGFTYSYKTVNIMVR 248
            ..||||.|.||||||.|.:    |||||.||.|.|   |.:..|:.|..|.|:.||.|...:.:|
Human   398 ENNCAAFYRGAWWYRNCHT----SNLNGQYLRGAH---ASYADGVEWSSWTGWQYSLKFSEMKIR 455

  Fly   249 P 249
            |
Human   456 P 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 85/196 (43%)
FIBCD1NP_001138578.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..238
FReD 241..457 CDD:238040 85/196 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 188 1.000 Inparanoid score I3915
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - otm40314
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.