DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and Fgl2

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_445907.2 Gene:Fgl2 / 84586 RGDID:620170 Length:429 Species:Rattus norvegicus


Alignment Length:238 Identity:84/238 - (35%)
Similarity:121/238 - (50%) Gaps:31/238 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YKKYSSSCKE---LNPKKSGVQKIQVG--SDVIEVYCDVTIAGKGWLVVQRRVSVEENFYRNWTS 91
            ||    .|.:   |..:.||..::...  :...|||||:...|.||.|:|.|:....||.|.|..
  Rat   200 YK----DCSDYYVLGKRSSGTYRVTPDHRNSSFEVYCDMETTGGGWTVLQARLDGSTNFTRGWKD 260

  Fly    92 YQTGFGDLKGNFFIGLNNLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNYPITQLGA 156
            |:.|||:|:..|::|.:.::.::..:...|.|:|.||.|...||.|..|:|.|.:..|.: .||.
  Rat   261 YKAGFGNLEREFWLGNDKIHLLTKSKEMILRIDLEDFNGLTLYAVYDQFYVANEFLKYRL-HLGN 324

  Fly   157 YSGTAGDSLSY-----HLYQPFSTFDRDNDN-ATINCAARYMGAWWYRECLSRIPCSNLNGAYLG 215
            |:|||||:|.:     |..:.|:|.|||||. .:.||...|...||:..|||    :||||.|. 
  Rat   325 YNGTAGDALRFSRHYNHDLRFFTTPDRDNDRYPSGNCGLYYSSGWWFDACLS----ANLNGKYY- 384

  Fly   216 GNHTDPALFGSGIVWGEWK--------GFTYSYKTVNIMVRPK 250
              |.......:||.||.|.        |:.:|:|...:|:|||
  Rat   385 --HQRYKGVRNGIFWGTWPGVSQAHPGGYKFSFKKAKMMIRPK 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 80/234 (34%)
Fgl2NP_445907.2 ApoLp-III_like <71..177 CDD:304399
Fibrinogen_C 199..425 CDD:278572 82/236 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.