DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and ANGPTL6

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_011526650.1 Gene:ANGPTL6 / 83854 HGNCID:23140 Length:537 Species:Homo sapiens


Alignment Length:213 Identity:78/213 - (36%)
Similarity:120/213 - (56%) Gaps:6/213 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 SSCKELNPKKSGVQKIQVGSDVIEVYCDVTIAGKGWLVVQRRVSVEENFYRNWTSYQTGFGDLKG 101
            :..::...::|||.:::||..|:.|:|:..:.|.||.|:|||.....||:..|..|:.|||...|
Human   328 AEARQAGHEQSGVYELRVGRHVVSVWCEQQLEGGGWTVIQRRQDGSVNFFTTWQHYKAGFGRPDG 392

  Fly   102 NFFIGLNNLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNYPITQLGAYSGTAGDSLS 166
            .:::||..:.:::|....||.:.|.|:.|....|||..|.:.....:|.: :||.|.|.||||||
Human   393 EYWLGLEPVYQLTSRGDHELLVLLEDWGGRGARAHYDGFSLEPESDHYRL-RLGQYHGDAGDSLS 456

  Fly   167 YHLYQPFSTFDRDNDNATINCAARYMGAWWYRECLSRIPCSNLNGAYLGGNHTDPALFGSGIVWG 231
            :|..:||||.|||.|:.:.|||....|.|||..|..    |||||.:..|.|. .:.:..|:.|.
Human   457 WHNDKPFSTVDRDRDSYSGNCALYQRGGWWYHACAH----SNLNGVWHHGGHY-RSRYQDGVYWA 516

  Fly   232 EWKGFTYSYKTVNIMVRP 249
            |::|..||.:...:::||
Human   517 EFRGGAYSLRKAAMLIRP 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 78/213 (37%)
ANGPTL6XP_011526650.1 FReD 322..535 CDD:238040 78/213 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.