DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and Fcna

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_112638.2 Gene:Fcna / 83517 RGDID:621221 Length:335 Species:Rattus norvegicus


Alignment Length:219 Identity:88/219 - (40%)
Similarity:117/219 - (53%) Gaps:27/219 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YKKYSSSCKELNPKKSGVQKIQVGSDVIEVYCDVTIAGKGWLVVQRRVSVEENFYRNWTSYQTGF 96
            |..|...|:.|.                 |.||:.:.|.||.|.||||....||||:|.||:.||
  Rat   140 YTIYLPDCRPLT-----------------VLCDMDVDGGGWTVFQRRVDGSINFYRDWDSYKRGF 187

  Fly    97 GDLKGNFFIGLNNLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNYPITQLGAY-SGT 160
            |:|...|::|.:.|:.:::...|||.::|.:|.|:..:|.||.|.|......|.:| ||.: .||
  Rat   188 GNLGTEFWLGNDYLHLLTANGNQELRVDLREFQGQTSFAKYSSFQVSGEQEKYKLT-LGQFLEGT 251

  Fly   161 AGDSLSYHLYQPFSTFDRDND-NATINCAARYMGAWWYRECLSRIPCSNLNGAYLGGNHTDPALF 224
            |||||:.|....|||.|:||| |...||||.:.|||||.:|..    |||||.||.|:|..   :
  Rat   252 AGDSLTKHNNMAFSTHDQDNDTNGGKNCAALFHGAWWYHDCHQ----SNLNGRYLPGSHES---Y 309

  Fly   225 GSGIVWGEWKGFTYSYKTVNIMVR 248
            ..||.|...:|..||||...:.:|
  Rat   310 ADGINWLSGRGHRYSYKVAEMKIR 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 87/217 (40%)
FcnaNP_112638.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 47..114
Collagen <67..108 CDD:396114
FReD 123..333 CDD:238040 87/217 (40%)
A domain, contributes to trimerization. /evidence=ECO:0000250 123..162 8/38 (21%)
B domain, contributes to trimerization. /evidence=ECO:0000250 163..251 35/88 (40%)
Carbohydrate-binding. /evidence=ECO:0000250|UniProtKB:O00602 291..293 0/1 (0%)
P domain. /evidence=ECO:0000250|UniProtKB:O00602 326..335 2/8 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm12326
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.