DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and fibcd1

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_031746424.1 Gene:fibcd1 / 779974 XenbaseID:XB-GENE-483361 Length:464 Species:Xenopus tropicalis


Alignment Length:196 Identity:84/196 - (42%)
Similarity:112/196 - (57%) Gaps:13/196 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 EVYCDVTIAGKGWLVVQRRVSVEENFYRNWTSYQTGFGDLKGNFFIGLNNLNKISSLQPQELYIE 124
            :|:||:|..|.||.|.|||.....||::.|..|:.|||.|.|..::||..::.::.....:|.|:
 Frog   273 QVFCDMTTDGGGWTVFQRREDGSVNFFQGWEQYRDGFGKLTGEHWLGLQRIHLLTMQTHYQLRID 337

  Fly   125 LVDFAGEKRYAHYSVFHVGNVYSN-----YPITQLGAYSGTAGDSLSYHLYQPFSTFDRDNDNAT 184
            |.||.....||.|:.|.||....|     |||| :..|:|||||||..|....|:|.|.|||::.
 Frog   338 LEDFENATAYALYNTFGVGLFSVNPEEDGYPIT-ISDYTGTAGDSLGKHSGMKFTTKDMDNDHSE 401

  Fly   185 INCAARYMGAWWYRECLSRIPCSNLNGAYLGGNHTDPALFGSGIVWGEWKGFTYSYKTVNIMVRP 249
            .|||:.|.||||||.|.:    |||||.||.|:|   |.:..||.|..|.|:.||.|...:.:||
 Frog   402 NNCASFYHGAWWYRNCHT----SNLNGQYLRGHH---ASYADGIEWSSWTGWQYSLKFTEMKIRP 459

  Fly   250 K 250
            :
 Frog   460 Q 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 83/194 (43%)
fibcd1XP_031746424.1 FReD 244..459 CDD:238040 82/193 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm14088
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.