Sequence 1: | NP_001246376.1 | Gene: | CG5550 / 36883 | FlyBaseID: | FBgn0034160 | Length: | 250 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_003276.3 | Gene: | TNR / 7143 | HGNCID: | 11953 | Length: | 1358 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 86/206 - (41%) |
---|---|---|---|
Similarity: | 126/206 - (61%) | Gaps: | 15/206 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 47 SGVQKIQVGSDV---IEVYCDVTIAGKGWLVVQRRVSVEENFYRNWTSYQTGFGDLKGNFFIGLN 108
Fly 109 NLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNYPITQLGAYSGTAGDSLSYHLYQPF 173
Fly 174 STFDRDNDNATINCAARYMGAWWYRECLSRIPCSNLNGAYLGGNHTDPALFGSGIVWGEWKGFTY 238
Fly 239 SYKTVNIMVRP 249 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5550 | NP_001246376.1 | FReD | 34..250 | CDD:238040 | 86/206 (42%) |
TNR | NP_003276.3 | EGF_2 | <208..230 | CDD:285248 | |
EGF_2 | 267..292 | CDD:285248 | |||
EGF_2 | 299..323 | CDD:285248 | |||
fn3 | 328..398 | CDD:278470 | |||
fn3 | 416..496 | CDD:278470 | |||
fn3 | 505..583 | CDD:278470 | |||
FN3 | 595..679 | CDD:238020 | |||
fn3 | 687..766 | CDD:278470 | |||
fn3 | 776..855 | CDD:278470 | |||
fn3 | 865..944 | CDD:278470 | |||
fn3 | 954..1026 | CDD:278470 | |||
FN3 | 1042..1127 | CDD:238020 | |||
FReD | 1133..1342 | CDD:238040 | 84/204 (41%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 167 | 1.000 | Domainoid score | I3858 |
eggNOG | 1 | 0.900 | - | - | E1_KOG2579 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR19143 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R6496 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.940 |