Sequence 1: | NP_001246376.1 | Gene: | CG5550 / 36883 | FlyBaseID: | FBgn0034160 | Length: | 250 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011240901.1 | Gene: | Angptl6 / 70726 | MGIID: | 1917976 | Length: | 474 | Species: | Mus musculus |
Alignment Length: | 203 | Identity: | 79/203 - (38%) |
---|---|---|---|
Similarity: | 116/203 - (57%) | Gaps: | 6/203 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 46 KSGVQKIQVGSDVIEVYCDVTIAGKGWLVVQRRVSVEENFYRNWTSYQTGFGDLKGNFFIGLNNL 110
Fly 111 NKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNYPITQLGAYSGTAGDSLSYHLYQPFST 175
Fly 176 FDRDNDNATINCAARYMGAWWYRECLSRIPCSNLNGAYLGGNHTDPALFGSGIVWGEWKGFTYSY 240
Fly 241 KTVNIMVR 248 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5550 | NP_001246376.1 | FReD | 34..250 | CDD:238040 | 79/203 (39%) |
Angptl6 | XP_011240901.1 | PRK09039 | 57..>154 | CDD:181619 | |
AMH_N | <116..197 | CDD:368070 | |||
FReD | 259..470 | CDD:238040 | 78/201 (39%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG2579 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X25 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |