DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and Angptl6

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_011240901.1 Gene:Angptl6 / 70726 MGIID:1917976 Length:474 Species:Mus musculus


Alignment Length:203 Identity:79/203 - (38%)
Similarity:116/203 - (57%) Gaps:6/203 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KSGVQKIQVGSDVIEVYCDVTIAGKGWLVVQRRVSVEENFYRNWTSYQTGFGDLKGNFFIGLNNL 110
            :|||..:::|..|:.|:|:....|.||.|:|||.....||:.||..|:.|||..:|.:::||..:
Mouse   274 QSGVYDLRLGRRVVAVWCEQQQEGGGWTVIQRRQDGSVNFFTNWQHYKAGFGRPEGEYWLGLEPV 338

  Fly   111 NKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNYPITQLGAYSGTAGDSLSYHLYQPFST 175
            ::::|....||.|.|.|:.|....|||..|.:.....:|.: :||.|.|.||||||:|..:||||
Mouse   339 HQVTSRGDHELLILLEDWGGRAARAHYDSFSLEPESDHYRL-RLGQYHGDAGDSLSWHNDKPFST 402

  Fly   176 FDRDNDNATINCAARYMGAWWYRECLSRIPCSNLNGAYLGGNHTDPALFGSGIVWGEWKGFTYSY 240
            .|||.|:.:.|||..:.|.|||..|..    |||||.:..|.|. .:.:..|:.|.|::|..||.
Mouse   403 VDRDRDSYSGNCALYHRGGWWYHACAH----SNLNGVWYHGGHY-RSRYQDGVYWAEFRGGAYSL 462

  Fly   241 KTVNIMVR 248
            |...::.|
Mouse   463 KKAVMLTR 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 79/203 (39%)
Angptl6XP_011240901.1 PRK09039 57..>154 CDD:181619
AMH_N <116..197 CDD:368070
FReD 259..470 CDD:238040 78/201 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.