DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and fgb

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001107962.1 Gene:fgb / 594921 XenbaseID:XB-GENE-483216 Length:490 Species:Xenopus tropicalis


Alignment Length:250 Identity:87/250 - (34%)
Similarity:122/250 - (48%) Gaps:44/250 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 CKELNPK---KSGVQKIQVGS--DVIEVYCDVTIAGKGWLVVQRRVSVEENFYRNWTSYQTGFG- 97
            |:|:..|   .|.:..||..|  ...:||||:.....||.|:|.|.....||.|.|.||::||| 
 Frog   242 CEEIYRKGGETSEMYLIQPDSFFRPFKVYCDMATHDGGWTVIQNRQDGSVNFGRTWDSYKSGFGN 306

  Fly    98 ----------DLKGNFFIGLNNLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNYPIT 152
                      |:.|.:::|...::::::|...|..||:.|:.|.|..|.|:.|.|.|..:.|.::
 Frog   307 IAANGGKGICDMPGEYWLGNEKISQLTNLGATEALIEMEDWDGAKVTAQYTGFTVQNEANKYQLS 371

  Fly   153 QLGAYSGTAGDSL--------------SYHLYQPFSTFDRDND---NATIN--CAARYMGAWWYR 198
            ..| |.||||::|              :.|....|||||||||   :|..|  |:....|.|||.
 Frog   372 VSG-YKGTAGNALMEGASQLKGENRTMTIHNGMFFSTFDRDNDGWQHADPNKQCSKEDGGGWWYN 435

  Fly   199 ECLSRIPCSNLNGAYL-GGNHT-DPALFGS--GIVWGEWKGFTYSYKTVNIMVRP 249
            .|    ..:|.||.|. ||.:| |.|..|:  |:||..||...||.|.:.|.:||
 Frog   436 RC----HAANPNGRYYWGGYYTWDMAKHGTDDGVVWMNWKDSWYSMKNMCIKIRP 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 86/249 (35%)
fgbNP_001107962.1 Fib_alpha 93..235 CDD:285864
FReD 238..487 CDD:294064 86/249 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.