DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and angptl2a

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001025401.1 Gene:angptl2a / 569092 ZFINID:ZDB-GENE-080721-15 Length:525 Species:Danio rerio


Alignment Length:227 Identity:78/227 - (34%)
Similarity:126/227 - (55%) Gaps:20/227 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 SSCKELNPKKSGVQKIQVG--------------SDVIEVYCDVTIAGKGWLVVQRRVSVEENFYR 87
            |:.|...|.|..:|.::.|              :.:::|:||......||.|:|||:....||:|
Zfish   299 STDKLSGPFKDCLQALEEGHSNSGMFLLKPENTNKLMQVWCDQRHDPGGWTVIQRRMDGSVNFFR 363

  Fly    88 NWTSYQTGFGDLKGNFFIGLNNLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNYPIT 152
            ||.:|:.|||::.|.:::||.|:..:::....:|.:.|.|::|.|.:|.|:.|.:......|.: 
Zfish   364 NWETYKQGFGNIDGEYWLGLENIYWLTNQGNYKLLVTLEDWSGRKTFAEYASFRLEPEADFYKM- 427

  Fly   153 QLGAYSGTAGDSLSYHLYQPFSTFDRDNDNATINCAARYMGAWWYRECLSRIPCSNLNGAYLGGN 217
            ::|.|.|.||||:::|..:.|:|.|||:|..|.|||....|.|||..|..    |||||.:..|.
Zfish   428 RVGRYHGNAGDSMTWHNGKQFTTLDRDHDAYTGNCAHYQKGGWWYNACAH----SNLNGVWYRGG 488

  Fly   218 HTDPALFGSGIVWGEWKGFTYSYKTVNIMVRP 249
            |. .:.:..|:.|.|::|.:||.|.|.:|:||
Zfish   489 HY-RSRYQDGVYWAEFRGGSYSLKKVTMMIRP 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 78/227 (34%)
angptl2aNP_001025401.1 DUF1875 <50..>147 CDD:286100
Fib_alpha 119..215 CDD:285864
FReD 305..519 CDD:238040 74/219 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6515
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.