DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and fibcd1b

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_005171959.1 Gene:fibcd1b / 567525 ZFINID:ZDB-GENE-070424-245 Length:492 Species:Danio rerio


Alignment Length:196 Identity:87/196 - (44%)
Similarity:116/196 - (59%) Gaps:15/196 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 EVYCDVTIAGKGWLVVQRRVSVEENFYRNWTSYQTGFGDLKGNFFIGLNNLNKISSLQPQELYIE 124
            :||||::..|.||.|:|||.....||:|.|.||:.|||.:.|.:::||..::.:|.....||.|:
Zfish   298 QVYCDMSTDGGGWTVIQRREDGSVNFFREWDSYREGFGKITGEYWLGLKQIHALSIQGNYELRID 362

  Fly   125 LVDFAGEKRYAHYSVFHVGNVYS------NYPITQLGAYSGTAGDSLSYHLYQPFSTFDRDNDNA 183
            |.||.....:|.|.||.|| ::|      .||:| :..|:|||||||..|....|:|.|||||::
Zfish   363 LEDFENSTAFAQYGVFGVG-LFSVDPEDDGYPLT-IADYTGTAGDSLLKHNGMKFTTKDRDNDHS 425

  Fly   184 TINCAARYMGAWWYRECLSRIPCSNLNGAYLGGNHTDPALFGSGIVWGEWKGFTYSYKTVNIMVR 248
            ..|||:.|.||||||.|.:    |||||.||.|.||.   :..||.|..|.|:.||.|...:.:|
Zfish   426 ENNCASFYHGAWWYRNCHT----SNLNGQYLRGQHTS---YADGIEWSSWTGWQYSLKFTEMKIR 483

  Fly   249 P 249
            |
Zfish   484 P 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 87/196 (44%)
fibcd1bXP_005171959.1 FReD 269..484 CDD:238040 85/194 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm6504
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.