DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and LOC566119

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001315003.1 Gene:LOC566119 / 566119 -ID:- Length:245 Species:Danio rerio


Alignment Length:250 Identity:76/250 - (30%)
Similarity:125/250 - (50%) Gaps:26/250 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LFYLASAEIGENVKIQTYKKYSSSCKELNPK---KSGVQKIQV------GSDVIEVYCDVTIAGK 70
            :::||:.     |.:.:...|....|.|:..   |||.:..:|      |......:|.:...|:
Zfish     4 IWFLAAL-----VSVASAIDYRDRYKPLDCSHHYKSGERFSKVYTIHPDGDHPHHAFCHMVSDGR 63

  Fly    71 -----GWLVVQRRVSVEENFYRNWTSYQTGFGDLKGNFFIGLNNLNKISSLQPQELYIELVDFAG 130
                 ||.|:|||:....|||:.|..|:.|||.::|..::||.:::.::..:...|.:::.||.|
Zfish    64 DEDNGGWTVIQRRMDGTLNFYQPWKEYKRGFGSMEGEHWMGLEHIHHMTRHKRHMLRVDMEDFEG 128

  Fly   131 EKRYAHYSVFHVGNVYSNYPITQLGAYSGTAGDSLSYHLYQPFSTFDRDNDNATINCAARYMGAW 195
            .:.:|||:.|.|.:....|.:...|...|.|||||:.|....|||||:|.|....|||..::|.:
Zfish   129 RRGFAHYTSFSVASEDDGYKLHISGFRDGGAGDSLTAHNEMKFSTFDKDQDLYEKNCAREFLGGF 193

  Fly   196 WYRECLSRIPCSNLNGAYLGGNHTDPALFGSGIVWGEWKGFTY-SYKTVNIMVRP 249
            ||::|..    :|.||.||.|:  |...:..|:.|..|....| |.|.:.:.::|
Zfish   194 WYKKCHH----ANPNGVYLWGH--DRTHYAIGVCWWSWDHNYYNSLKHITMRIKP 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 72/230 (31%)
LOC566119NP_001315003.1 FReD 25..242 CDD:238040 70/222 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.