DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and fgl1b

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_017213536.1 Gene:fgl1b / 563523 ZFINID:ZDB-GENE-130530-668 Length:348 Species:Danio rerio


Alignment Length:237 Identity:82/237 - (34%)
Similarity:119/237 - (50%) Gaps:31/237 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 YSSSCKELNPK---KSGVQKIQVGSDVIE---VYCDVTIAGKGWLVVQRRVSVEENFYRNWTSYQ 93
            :...|.||..:   .||..:|: ...::|   ||||:...| .|.|:|:|::.:.:|.|.|..|:
Zfish   106 HDKDCSELYDRLKPVSGFYRIK-PKPLLEPFLVYCDMDDGG-AWTVIQKRINGKVDFDRKWEDYK 168

  Fly    94 TGFGDL---KGNFFIGLNNLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNYPITQLG 155
            .|||:.   |..|::|.::::.:.|.....:.|:|.|:.|.|.||.|..|.|.:....|.: ..|
Zfish   169 NGFGNFQSSKDEFWLGNDHIHVLLSDGDSVMKIDLTDWKGGKSYAMYDNFKVSDEKDKYRL-YYG 232

  Fly   156 AYSGTAGDSLS-----------YHLYQPFSTFDRDNDN-ATINCAARYMGAWWYRECLSRIPCSN 208
            .|||.|||:||           .|....|||.|:|:|. ...:|||...|.|||..|    ..:|
Zfish   233 MYSGQAGDALSGGANMVEQWSASHNGMQFSTRDQDHDRYLQGSCAAENKGGWWYNRC----HAAN 293

  Fly   209 LNGA-YLGGNHTDPALFGSGIVWGEWKGFTYSYKTVNIMVRP 249
            |||. |.||.:  .|.:.:||||..|||..||.:...:.|||
Zfish   294 LNGRFYRGGEY--KAKYDNGIVWSTWKGLWYSLRHTVMKVRP 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 82/237 (35%)
fgl1bXP_017213536.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.