DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and angptl6

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001014821.1 Gene:angptl6 / 561927 ZFINID:ZDB-GENE-030131-9735 Length:489 Species:Danio rerio


Alignment Length:211 Identity:80/211 - (37%)
Similarity:120/211 - (56%) Gaps:8/211 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 ELNPKKSGVQKIQVGSD--VIEVYCDVTIAGKGWLVVQRRVSVEENFYRNWTSYQTGFGDLKGNF 103
            |...|.||:..::..:.  :::.:||.:.|..||.|:|||.....||:|.|..|:.|||:|.|.:
Zfish   284 ESGEKTSGIYLLRPRNTNRLLQAWCDQSRAQGGWTVIQRRQDGSVNFFRTWDQYKQGFGNLDGEY 348

  Fly   104 FIGLNNLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNYPITQLGAYSGTAGDSLSYH 168
            ::||.:|..::|....:|.:.:.|:.|.:.||.|..|.| ...|::...:||:|.||||||||:|
Zfish   349 WLGLEHLYWLTSQATYKLRVAMEDWQGRQVYAEYDSFRV-EPESDWYRLRLGSYQGTAGDSLSWH 412

  Fly   169 LYQPFSTFDRDNDNATINCAARYMGAWWYRECLSRIPCSNLNGAYLGGNHTDPALFGSGIVWGEW 233
            ..:.|:|.|||.|..|.|||....|.|||..|..    |||||.:..|.|. .:.:..|:.|.|:
Zfish   413 NNKAFTTLDRDKDAYTGNCAHYQKGGWWYHMCAH----SNLNGVWYRGGHY-RSRYQDGVYWAEF 472

  Fly   234 KGFTYSYKTVNIMVRP 249
            .|.:||.|.|.:|::|
Zfish   473 HGGSYSLKKVAMMIKP 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 80/211 (38%)
angptl6NP_001014821.1 DUF1640 <46..150 CDD:285090
DUF4349 <126..230 CDD:305044
FReD 274..488 CDD:238040 79/209 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I4088
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm6515
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.