DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and LOC555374

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_009294451.1 Gene:LOC555374 / 555374 -ID:- Length:242 Species:Danio rerio


Alignment Length:252 Identity:85/252 - (33%)
Similarity:128/252 - (50%) Gaps:23/252 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LCVFSLGLFYLASAEIGENVKIQTYKKYSSSCKEL---NPKKSGVQKI-QVGSDVIEVYCDVTIA 68
            :.||.:.|..:.:|.:     :..:|.:  .|.|:   ....||:..| ..|:....|||.:...
Zfish     2 MTVFVVALLSVFTASV-----VSGFKPF--DCSEIYKSGQTVSGIYSIYPAGNIPASVYCQMISD 59

  Fly    69 GK-----GWLVVQRRVSVEENFYRNWTSYQTGFGDLKGNFFIGLNNLNKISSLQPQELYIELVDF 128
            ||     ||.|.|||:....:|||.|..|:.|||:::|.:::||.||.:::..:...|.::|.||
Zfish    60 GKDEENGGWTVFQRRMDGSVSFYRLWEEYKRGFGNVEGEYWLGLENLYQLTQHKKFMLRVDLEDF 124

  Fly   129 AGEKRYAHYSVFHVGNVYSNYPITQLGAYSGTAGDSLSYHLYQPFSTFDRDNDNATINCAARYMG 193
            .|.:.:|.||.|.||:....|.:...|...|.|||||.:|....|:|:|:|.||...|||..|:|
Zfish   125 TGRRGFAQYSSFSVGSEAEGYKLQVSGFTDGGAGDSLFFHNGMKFTTYDKDQDNTEKNCARMYLG 189

  Fly   194 AWWYRECLSRIPCSNLNGAYLGGNHTDPALFGSGIVWGEWK-GFTYSYKTVNIMVRP 249
            .:||..|    ..:|.||.||||.  |..:|..|.||..|| ......|.:.:.::|
Zfish   190 GFWYNAC----HYANPNGVYLGGE--DKTVFAIGNVWYTWKNNLDIGMKFITMKIKP 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 80/226 (35%)
LOC555374XP_009294451.1 FReD 23..241 CDD:238040 80/226 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D405297at33208
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.