DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and fcn2

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_031747902.1 Gene:fcn2 / 548398 XenbaseID:XB-GENE-5789613 Length:312 Species:Xenopus tropicalis


Alignment Length:246 Identity:84/246 - (34%)
Similarity:119/246 - (48%) Gaps:35/246 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GENVKIQTYKKYSS----------SCKELNPKKSGVQKIQVGSDVIEVY----------CDVTIA 68
            ||::|.:...|..|          :||||      :.:.::.:|...:|          ||:...
 Frog    80 GESIKGEKGDKGDSGRLDSLYAAKNCKEL------LDQGEILTDWYTIYPENTQPMKVLCDMHTD 138

  Fly    69 GKGWLVVQRRVSVEENFYRNWTSYQTGFGDLKGNFFIGLNNLNKISSLQPQELYIELVDFAGEKR 133
            |.||:|.|||.....||.|:|.||:||||:....|::|..||.:::|....||.|||.||.....
 Frog   139 GGGWIVFQRRWDGSVNFNRDWNSYKTGFGNRLNEFWLGNENLYELTSSGTWELRIELQDFENVNY 203

  Fly   134 YAHYSVFHVGNVYSNYPITQLGAYSGTAGDSLSYHLYQPFSTFDRDNDNATINCAARYMGAWWYR 198
            :..||.|.:......|.:.......|..|:|:..|:..||||.  |||.:...|.|:|.|.|||.
 Frog   204 FVIYSSFKLLGEADKYKLLLGNLKEGNIGNSMDVHVNMPFSTL--DNDVSPGKCVAKYKGGWWYN 266

  Fly   199 ECLSRIPCSNLNGAYLGGNHTDPALFGSGIVWGEWKGFTYSYKTVNIMVRP 249
            :|..    :||||.||.|.|:.   :..||.|...||:.||||...:.:||
 Frog   267 DCHH----ANLNGPYLPGQHSS---YADGINWASGKGYHYSYKHSEMKIRP 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 81/236 (34%)
fcn2XP_031747902.1 FReD 103..311 CDD:238040 79/223 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I3986
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm14088
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.