DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and angptl1a

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001014820.1 Gene:angptl1a / 544656 ZFINID:ZDB-GENE-040724-269 Length:480 Species:Danio rerio


Alignment Length:219 Identity:86/219 - (39%)
Similarity:125/219 - (57%) Gaps:10/219 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KYSSSCKELNPKKSGVQKIQV-GSD-VIEVYCDVTIAGKGWLVVQRRVSVEENFYRNWTSYQTGF 96
            |..|..::.....||:..::. ||| :|:.:|:..:...||.|.|||.....||:|||.:|:.||
Zfish   267 KDCSQVRQAGHSTSGMYLLKAEGSDRLIQAWCEHKLDNGGWTVFQRRKDGSVNFFRNWENYKKGF 331

  Fly    97 GDLKGNFFIGLNNLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNYPITQLGAYSGTA 161
            |::.|..::||.|:..::.....:|.:||.|:.|:|.||.||.||:......:.: :||.|.|.|
Zfish   332 GNIDGEHWLGLENIYNLAKQGDYKLLVELEDWVGKKVYAEYSSFHLEPESEGFRL-RLGTYQGNA 395

  Fly   162 GDSLSYHLYQPFSTFDRDNDNATINCAARYMGAWWYRECLSRIPCSNLNGA-YLGGNHTDPALFG 225
            ||||:.|..:||:|.|||.|..|.|||..:.|.|||..|..    :||||. |.||.:.  :.|.
Zfish   396 GDSLTSHNGKPFTTLDRDKDAFTGNCAHFHKGGWWYNACGQ----TNLNGVWYSGGVYR--SKFQ 454

  Fly   226 SGIVWGEWKGFTYSYKTVNIMVRP 249
            .||.|.|:.|..||.|:|.:|:||
Zfish   455 DGIFWAEYGGGYYSLKSVRMMIRP 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 86/219 (39%)
angptl1aNP_001014820.1 FReD 264..479 CDD:238040 86/219 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6515
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.