DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and ANGPTL4

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_005272541.1 Gene:ANGPTL4 / 51129 HGNCID:16039 Length:424 Species:Homo sapiens


Alignment Length:245 Identity:76/245 - (31%)
Similarity:109/245 - (44%) Gaps:49/245 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 CKEL---NPKKSGVQKIQ-VGSDVIEVYCDVTIAGKGWLVVQRRVSVEENFYRNWTSYQTGFGDL 99
            |:||   ..::||:.:|| .||....|.|.:|..| ||.|:|||.....:|.|.|.:|:.||||.
Human   188 CQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDG-GWTVIQRRHDGSVDFNRPWEAYKAGFGDP 251

  Fly   100 KGNFFIGLNNLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNY------PIT-QLGAY 157
            .|.|::||..::.|:..:...|.::|.|:.|......:|| |:|...:.|      |:. ||||.
Human   252 HGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSV-HLGGEDTAYSLQLTAPVAGQLGAT 315

  Fly   158 ----SGTAGDSLSYHLYQPFSTFDRDND-NATINCAARY------------------MGAWWYRE 199
                ||         |..||||:|:|:| ....|||...                  .|.||:..
Human   316 TVPPSG---------LSVPFSTWDQDHDLRRDKNCAKSLSAPSVAQRPDHVPSPLTPAGGWWFGT 371

  Fly   200 CLSRIPCSNLNGAYLGGNHTDPALFGSGIVWGEWKGFTYSYKTVNIMVRP 249
            |..    |||||.|.............||.|..|:|..|..:...::::|
Human   372 CSH----SNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQP 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 76/245 (31%)
ANGPTL4XP_005272541.1 FReD 183..418 CDD:238040 76/245 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.