DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and angptl4

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001243132.1 Gene:angptl4 / 492647 ZFINID:ZDB-GENE-041111-222 Length:460 Species:Danio rerio


Alignment Length:225 Identity:79/225 - (35%)
Similarity:110/225 - (48%) Gaps:21/225 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 SSSCKEL---NPKKSGVQKIQVG-SDVIEVYCDVTIAGKGWLVVQRRVSVEENFYRNWTSYQTGF 96
            :|.|.||   ....||:..||.. |...||||::|..| ||.|:|||.....:|.:.|.:||.||
Zfish   239 ASDCHELFLRGETSSGLYTIQPSDSQPFEVYCEMTPEG-GWTVIQRRQDGSVDFDQLWQAYQNGF 302

  Fly    97 GDLKGNFFIGLNNLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNYPITQLGAYSGTA 161
            |:|.|.|::||..::.:|......|.::..|:..|.:...|. ||:....:||.:..|.:.:|..
Zfish   303 GNLNGEFWLGLEKIHSVSKGGNYILKVQFSDWRDEIQSISYR-FHLNGQENNYSLRILESPAGNT 366

  Fly   162 GDSLSYHLYQ-PFSTFDRDNDNAT-INCAARYMGAWWYRECLSRIPCSNLNGAYLGGNHTDPA-- 222
            ..||...... ||||.|:|||... :|||.:..|.||:..| .|   |||||.|.    ..||  
Zfish   367 ESSLPTETSAVPFSTRDKDNDQKNDLNCAKQLSGGWWFSNC-GR---SNLNGRYF----VTPAPK 423

  Fly   223 ---LFGSGIVWGEWKGFTYSYKTVNIMVRP 249
               ....|:.|..|:|..|..||..:|:.|
Zfish   424 QRHQRKQGVFWKTWRGRYYPLKTTTMMIAP 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 79/225 (35%)
angptl4NP_001243132.1 DUF4795 78..>224 CDD:292662
FReD 240..453 CDD:238040 78/222 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.