DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and MFAP4

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001185624.1 Gene:MFAP4 / 4239 HGNCID:7035 Length:279 Species:Homo sapiens


Alignment Length:195 Identity:81/195 - (41%)
Similarity:110/195 - (56%) Gaps:12/195 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 IEVYCDVTIAGKGWLVVQRRVSVEENFYRNWTSYQTGFGDLKGNFFIGLNNLNKISSLQPQELYI 123
            :.|:||:|..|..|.|.|:|.:...:|:|.|..|:.|||...|.:::||.|::.::..|..||.:
Human    90 VPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLKQKYELRV 154

  Fly   124 ELVDFAGEKRYAHYSVFHVG-NVYS----NYPITQLGAYSGTAGDSLSYHLYQPFSTFDRDNDNA 183
            :|.||.....||.|:.|.:. |..|    .|.:...|...|.||||||||..|.|||||||.|..
Human   155 DLEDFENNTAYAKYADFSISPNAVSAEEDGYTLFVAGFEDGGAGDSLSYHSGQKFSTFDRDQDLF 219

  Fly   184 TINCAARYMGAWWYRECLSRIPCSNLNGAYLGGNHTDPALFGSGIVWGEWKGFTYSYKTVNIMVR 248
            ..||||...||:|:|.|    ..:||||.||||:|..   :.:||.|.:||||.||.|...:.:|
Human   220 VQNCAALSSGAFWFRSC----HFANLNGFYLGGSHLS---YANGINWAQWKGFYYSLKRTEMKIR 277

  Fly   249  248
            Human   278  277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 81/195 (42%)
MFAP4NP_001185624.1 FReD 60..278 CDD:238040 81/195 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 188 1.000 Inparanoid score I3915
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D405297at33208
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - otm40314
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.