DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and mfap4.1

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001315274.1 Gene:mfap4.1 / 405825 ZFINID:ZDB-GENE-040426-2246 Length:242 Species:Danio rerio


Alignment Length:209 Identity:80/209 - (38%)
Similarity:112/209 - (53%) Gaps:13/209 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SGVQKI-QVGSDVIEVYCDVTIAGK-----GWLVVQRRVSVEENFYRNWTSYQTGFGDLKGNFFI 105
            |||..| ..|...:.|||.:...||     ||.|:|||:....||||.|..|:.|||:::|.:::
Zfish    37 SGVYTIYPAGETPVWVYCQMLSDGKDEENGGWTVIQRRMDGSVNFYRPWRDYKRGFGNVEGEYWL 101

  Fly   106 GLNNLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNYPITQLGAYSGTAGDSLSYHLY 170
            ||.||.:::..:...|.::|.||.|.:.:|.||.|.||.....|.:...|...|.||||||.|..
Zfish   102 GLENLYQLTRHKKFMLRVDLEDFEGRRGFAQYSSFSVGCECEGYKLQVSGFTDGGAGDSLSGHNG 166

  Fly   171 QPFSTFDRDNDNATINCAARYMGAWWYRECLSRIPCSNLNGAYLGGNHTDPALFGSGIVWGEWKG 235
            ..|||||:|.|....|||..::||:||..|.:    :|.|..||.|.  |......|:.|..|||
Zfish   167 VKFSTFDKDQDTYDKNCAKEFLGAFWYGSCHT----TNPNAVYLWGE--DATHHAIGVCWYTWKG 225

  Fly   236 -FTYSYKTVNIMVR 248
             .|.|.|.:::.::
Zfish   226 THTVSMKIISMKIK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 80/209 (38%)
mfap4.1NP_001315274.1 FReD 23..239 CDD:238040 80/207 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D405297at33208
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm6504
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.