DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and CG7668

DIOPT Version :10

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_649170.1 Gene:CG7668 / 40190 FlyBaseID:FBgn0036929 Length:422 Species:Drosophila melanogaster


Alignment Length:200 Identity:68/200 - (34%)
Similarity:95/200 - (47%) Gaps:40/200 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 VYCDVTIAGKGWLVVQRRV------SVEENFYRNWTSYQTGFGDLKGNFFIGLNNLNKISSLQPQ 119
            |:.|:..||:||:::|||:      :.|.|..       ||.|||.|.|::||..|:|:::.:..
  Fly   250 VFEDIPSAGRGWMIIQRRIDGSFDNATESNII-------TGCGDLGGEFWLGLQKLHKMTTHRRM 307

  Fly   120 ELYIELVDFAGEKRYAHYSVFHVGNVYSNYPITQLGAYSGTAGDSLSYHLYQPFSTFDRDNDNAT 184
            ||||:||||.....||.|..|.:|:....|.:..||.|||.|||:...|:          |....
  Fly   308 ELYIQLVDFDNASAYARYDNFVIGDEKQKYKLLSLGEYSGNAGDAFRSHI----------NHIIV 362

  Fly   185 INCAARYMGAWWYRECLSRIPCSNLNGAYLGG----NHTDPALFGSGIVWGEWK-GFTYSYKTVN 244
            .|..|.....||     ..:.| ||||.|...    :.||      ||.||.|. |..|..|:..
  Fly   363 GNPFAMESSKWW-----GTMNC-NLNGKYRNSKVELDTTD------GIWWGNWNVGNRYPLKSCK 415

  Fly   245 IMVRP 249
            :::||
  Fly   416 MLIRP 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 67/199 (34%)
CG7668NP_649170.1 GumC <52..>242 CDD:442439
FReD 245..421 CDD:412152 67/199 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.