DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and CG7668

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_649170.1 Gene:CG7668 / 40190 FlyBaseID:FBgn0036929 Length:422 Species:Drosophila melanogaster


Alignment Length:200 Identity:68/200 - (34%)
Similarity:95/200 - (47%) Gaps:40/200 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 VYCDVTIAGKGWLVVQRRV------SVEENFYRNWTSYQTGFGDLKGNFFIGLNNLNKISSLQPQ 119
            |:.|:..||:||:::|||:      :.|.|..       ||.|||.|.|::||..|:|:::.:..
  Fly   250 VFEDIPSAGRGWMIIQRRIDGSFDNATESNII-------TGCGDLGGEFWLGLQKLHKMTTHRRM 307

  Fly   120 ELYIELVDFAGEKRYAHYSVFHVGNVYSNYPITQLGAYSGTAGDSLSYHLYQPFSTFDRDNDNAT 184
            ||||:||||.....||.|..|.:|:....|.:..||.|||.|||:...|:          |....
  Fly   308 ELYIQLVDFDNASAYARYDNFVIGDEKQKYKLLSLGEYSGNAGDAFRSHI----------NHIIV 362

  Fly   185 INCAARYMGAWWYRECLSRIPCSNLNGAYLGG----NHTDPALFGSGIVWGEWK-GFTYSYKTVN 244
            .|..|.....||     ..:.| ||||.|...    :.||      ||.||.|. |..|..|:..
  Fly   363 GNPFAMESSKWW-----GTMNC-NLNGKYRNSKVELDTTD------GIWWGNWNVGNRYPLKSCK 415

  Fly   245 IMVRP 249
            :::||
  Fly   416 MLIRP 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 67/199 (34%)
CG7668NP_649170.1 DUF16 146..>212 CDD:279814
FReD 245..421 CDD:294064 67/199 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446503
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.